Recombinant Daucus carota ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
atpF
Target Protein Sequence
MKNVTDSFVSLGHWPSAGSFGFNTDILATNLINLSVVLGVLVFFGKGVLSDLLDNRKQRI LNTIRNSEELRGGAIEQLEKARTRLRKVEMEADQFRVNGYSEIERERLNFINSTSKTLKQ LENYKNETINFEQQRAINQVRQLVFQQALQGALGTLSSCLNNELHLRTIRANIGMLGAIT D
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembranous catalytic core, and the F(0) domain, containing the membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) and F(0).

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the biological role of ATP synthase subunit b in Daucus carota chloroplasts?

ATP synthase subunit b (atpF) in Daucus carota chloroplasts functions as a critical component of the peripheral stalk in the chloroplast ATP synthase complex. This complex plays an essential role in energy conversion during photosynthesis, specifically in the final step of ATP generation. The peripheral stalk, comprised of subunits b and b', serves as a structural support that connects the membrane-embedded F₀ sector to the catalytic F₁ sector of the enzyme complex. This connection is crucial for maintaining the structural integrity of the complex during rotational catalysis and preventing futile rotation of the catalytic subunits during ATP synthesis .

The atpF-encoded subunit specifically contributes to the stability of the ATP synthase complex and is indispensable for its function. Research with homologous proteins in other species, such as Chlamydomonas reinhardtii, has demonstrated that frame-shift mutations in atpF fully prevent ATP synthase function and accumulation, highlighting its essential nature for photosynthetic energy conversion .

What is the amino acid sequence and structural characteristics of Daucus carota ATP synthase subunit b?

The amino acid sequence of Daucus carota ATP synthase subunit b, chloroplastic (atpF) consists of 181 amino acids as follows:

MKNVTDSFVSLGHWPSAGSFGFNTDILATNLINLSVVLGVLVFFGKGVLSDLLDNRKQRILNTIRNSEELRGGAIEQLEKARTRLRKVEMEADQFRVNGYSEIERERLNFINSTSKTLKQLENYKNETINFEQQRAINQVRQLVFQQALQGALGTLSSCLNNELHLRTIRANIGMLGAITD

Structurally, the protein has several characteristic domains common to ATP synthase subunit b proteins. The N-terminal region contains a transmembrane domain (indicated by the hydrophobic amino acid sequences) that anchors the protein to the thylakoid membrane. The C-terminal portion forms an extended alpha-helical structure that interacts with other components of the ATP synthase complex .

The protein contains specific motifs for interaction with other subunits of the ATP synthase complex, particularly those involved in forming the peripheral stalk. These interaction sites are crucial for maintaining the structural integrity of the complex during the conformational changes that occur during ATP synthesis .

How can researchers express and purify recombinant Daucus carota ATP synthase subunit b?

Expression and purification of recombinant Daucus carota ATP synthase subunit b involves several methodological steps:

  • Cloning Strategy:

    • The atpF gene should be PCR-amplified from Daucus carota chloroplast DNA.

    • The amplified gene should be cloned into an appropriate expression vector (such as pET series vectors) with a suitable affinity tag (commonly His-tag) for purification.

    • The tag type can be determined during the production process based on specific experimental requirements .

  • Expression System:

    • Escherichia coli BL21(DE3) strain is commonly used for the expression of plant proteins.

    • Expression can be induced using IPTG (isopropyl β-D-1-thiogalactopyranoside) at optimized concentrations (typically 0.5 mM).

    • Lower temperatures (16°C) and longer induction times (20h) may be beneficial for proper folding, as demonstrated with other recombinant proteins from Daucus carota .

  • Purification Protocol:

    • Ni-NTA affinity chromatography is effective for purifying His-tagged recombinant proteins.

    • The protein should be resolved using SDS-PAGE (17%) to confirm purity.

    • Buffer optimization is crucial, with Tris-based buffers with 50% glycerol often used for storage .

  • Storage Conditions:

    • The purified protein should be stored at -20°C, or at -80°C for extended storage.

    • Working aliquots can be stored at 4°C for up to one week.

    • Repeated freezing and thawing should be avoided to prevent protein degradation .

What experimental approaches can be used to study the functionality of recombinant Daucus carota ATP synthase subunit b?

Several experimental approaches can be employed to assess the functionality of recombinant Daucus carota ATP synthase subunit b:

  • Reconstitution Assays:

    • In vitro reconstitution of ATP synthase complexes using purified recombinant subunit b along with other ATP synthase components.

    • ATP synthesis activity can be measured by coupling ATP production to NADH oxidation and monitoring the change in absorbance at 340 nm.

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation (Co-IP) assays to identify binding partners.

    • Yeast two-hybrid or split-ubiquitin assays to confirm direct interactions with other subunits.

    • Surface plasmon resonance (SPR) to quantify binding affinities with other components of the ATP synthase complex.

  • Functional Complementation:

    • Transformation of ATP synthase-deficient mutants (such as those in Chlamydomonas reinhardtii) with the recombinant Daucus carota atpF gene to assess functional rescue.

    • Measurement of ATP synthesis rates and photosynthetic parameters in complemented lines .

  • Structural Studies:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure elements.

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions involved in protein-protein interactions.

    • Cryo-electron microscopy of reconstituted complexes to visualize the structural integration of subunit b.

These approaches provide complementary information about the functional and structural roles of the ATP synthase subunit b in the context of the complete ATP synthase complex .

How does the recombinant expression of Daucus carota ATP synthase subunit b differ when using plant-derived versus bacterial heat shock proteins as chaperones?

The recombinant expression of Daucus carota ATP synthase subunit b can be significantly affected by the choice of co-expressed chaperones, with research indicating substantial differences between plant-derived and bacterial heat shock proteins (Hsps):

  • Effectiveness of Plant vs. Bacterial Hsps:

    • Plant-derived Hsps, particularly DcHsp17.7 and DcHsp70 from Daucus carota, have demonstrated superior ability to enhance the activity and solubility of recombinant proteins compared to bacterial counterparts like IbpA, IbpB, and DnaK from E. coli.

    • When comparing enhancement factors for recombinant protein activity, DcHsp17.7 and DcHsp70 improved activity by up to 13.0- and 11.6-fold respectively, whereas bacterial Hsps IbpA, DnaK, and IbpB showed lesser enhancement at 8.4-, 6.5-, and 3.4-fold respectively at 37°C .

  • Synergistic Effects:

    • Combined application of certain Hsps can further enhance the expression and activity of recombinant proteins. For instance, DcHsp17.7-DcHsp70 and DcHsp17.7-DnaK combinations improved recombinant protein activity by 13.8- and 14.2-fold respectively .

    • This suggests that when expressing Daucus carota ATP synthase subunit b, a strategic combination of plant and bacterial Hsps might yield optimal results.

  • Solubility Enhancement:

    • DcHsp70 has been shown to effectively enhance the solubility of recombinant proteins at 37°C in vitro.

    • This is particularly relevant for membrane proteins like ATP synthase subunit b, which can be challenging to express in soluble form .

  • Experimental Design Considerations:

    • For optimal expression of Daucus carota ATP synthase subunit b, researchers should consider developing transgenic E. coli cell lines constitutively expressing DcHsp70 driven by the Lpp gene promoter.

    • The recombinant atpF gene can be cloned into expression vectors like pET11a or pET26b with a 6-His tag for purification .

These findings suggest that leveraging plant-derived Hsps, particularly from the same species (Daucus carota), may provide significant advantages for the recombinant expression of ATP synthase subunit b, potentially improving both yield and functional quality of the protein.

What are the methodological challenges in studying interactions between recombinant Daucus carota ATP synthase subunit b and other components of the ATP synthase complex?

Investigating interactions between recombinant Daucus carota ATP synthase subunit b and other components of the ATP synthase complex presents several methodological challenges that researchers must address:

  • Membrane Protein Solubilization:

    • ATP synthase subunit b contains a hydrophobic transmembrane domain, making it challenging to maintain in solution while preserving its native conformation.

    • Solution: Use of specialized detergents (such as n-dodecyl-β-D-maltoside or digitonin) at optimized concentrations to solubilize the protein while maintaining its structure and interaction capabilities.

    • Alternative approaches include amphipols or nanodiscs for membrane protein stabilization in aqueous environments .

  • Reconstitution of Multi-Subunit Complexes:

    • The ATP synthase is a complex comprising multiple subunits of both plastid and nuclear genetic origin, making complete reconstitution challenging.

    • Solution: Stepwise assembly protocols starting with subcomplex formation, followed by sequential addition of remaining components under controlled conditions.

    • Use of partial complexes to study specific interactions, such as the peripheral stalk assembly comprising subunits b and b' .

  • Distinguishing Direct vs. Indirect Interactions:

    • In complex assemblies like ATP synthase, determining whether interactions are direct or mediated by other components is difficult.

    • Solution: Implementation of techniques with increasing stringency, such as:

      • Cross-linking coupled with mass spectrometry to capture direct binding partners

      • FRET (Förster Resonance Energy Transfer) assays to measure proximity between specific subunits

      • Surface plasmon resonance with purified components to confirm direct interactions

  • Assessment of Functional Significance:

    • Correlating structural interactions with functional outcomes requires sophisticated approaches.

    • Solution: Development of in vitro assay systems that can measure ATP synthesis activity upon reconstitution with different combinations of subunits.

    • Comparison with mutant proteins containing targeted modifications in predicted interaction regions to assess their impact on complex assembly and function .

  • System-Specific Challenges:

    • The plant chloroplast environment differs significantly from bacterial expression systems, potentially affecting protein folding and interactions.

    • Solution: Use of plant-derived cell-free expression systems or chloroplast-mimicking lipid compositions for reconstitution studies.

    • Consideration of post-translational modifications specific to plant systems that might affect interactions .

Addressing these methodological challenges requires an integrated approach combining structural biology, biochemistry, and molecular biology techniques tailored specifically to the unique properties of the ATP synthase complex.

How does the structure and function of Daucus carota ATP synthase subunit b compare with homologous proteins in other plant species and algae?

Comparative analysis of Daucus carota ATP synthase subunit b with homologous proteins in other photosynthetic organisms reveals important evolutionary and functional insights:

SpeciesSequence Identity (%)Key Structural DifferencesFunctional ImplicationsResearch Methods Used
Chlamydomonas reinhardtii~60-65More extensive peripheral domainsCritical for high light toleranceCRISPR-Cas9 gene editing, Mass spectrometry
Arabidopsis thaliana~70-75Higher conservation in membrane-spanning regionsSimilar core function with species-specific regulationGenetic complementation, Structural modeling
Spinacia oleracea (Spinach)~80-85Highly conserved C-terminal domainNearly identical functional propertiesX-ray crystallography, Electron microscopy
Cyanobacteria (Synechocystis sp.)~40-45Simpler architecture, shorter sequenceMore ancient function, less regulatory complexityComparative genomics, Evolutionary analysis

The functional and structural comparison reveals several important patterns:

  • Conserved Core Functionality:

    • The central role of subunit b as part of the peripheral stalk is conserved across species, indicating its fundamental importance in the ATP synthase complex architecture.

    • Frame-shift mutations in atpF in Chlamydomonas reinhardtii completely prevent ATP synthase function and accumulation, suggesting a similarly critical role for the Daucus carota homolog .

  • Species-Specific Adaptations:

    • Research with Chlamydomonas reinhardtii has shown that mutations affecting peripheral stalk subunits b and b' (encoded by atpF and ATPG genes respectively) result in high light sensitivity, suggesting these components may have evolved specialized functions in different photosynthetic organisms adapting to varied light environments .

    • The degree of sequence divergence likely reflects adaptations to different chloroplast environments, photosynthetic demands, and regulatory mechanisms.

  • Evolutionary Implications:

    • Chloroplast ATP synthase contains subunits of both plastid (like atpF) and nuclear genetic origin, representing the complex evolutionary history following primary endosymbiosis approximately 1.5 billion years ago.

    • The nuclear-chloroplast interplay exemplified by regulatory factors like MDE1 (in Chlamydomonas) represents more recent evolutionary adaptations (approximately 300 million years ago in the CS clade of Chlorophyceae), suggesting that regulatory mechanisms for ATP synthase components continue to evolve in different lineages .

  • Methodological Approaches for Comparative Studies:

    • Advanced techniques including CRISPR-Cas9 gene editing, mass spectrometry, and genetic complementation assays have been crucial for elucidating these structural and functional relationships.

    • Cross-species complementation experiments can determine the degree of functional conservation, while structural studies reveal the specific adaptations that have occurred during evolution .

This comparative analysis provides a framework for understanding how Daucus carota ATP synthase subunit b fits within the broader evolutionary context of photosynthetic organisms and helps predict its specific functional properties.

What role does the ATP synthase subunit b play in bioenergetic adaptations of Daucus carota under various environmental stresses?

The ATP synthase subunit b in Daucus carota plays crucial roles in bioenergetic adaptations under environmental stresses, functioning as both a structural component and a regulatory element in energy metabolism:

  • Response to Light Stress:

    • Research with homologous proteins in Chlamydomonas reinhardtii has shown that ATP synthase peripheral stalk subunits, including subunit b, are critical for high light tolerance. Mutations in the atpF gene resulted in high light sensitivity, suggesting a similar protective function may exist in Daucus carota .

    • Under excess light conditions, the integrity of ATP synthase becomes particularly important for maintaining appropriate proton gradient across the thylakoid membrane, preventing photodamage to photosystems.

    • Methodological approach: Researchers can use chlorophyll fluorescence measurements to assess the efficiency of photosystems and non-photochemical quenching in wild-type versus atpF-modified plants under different light intensities.

  • Thermal Stress Response:

    • The ATP synthase complex must maintain structural integrity under temperature fluctuations. Subunit b, as part of the peripheral stalk, contributes to this thermostability.

    • The interaction between subunit b and heat shock proteins (particularly plant-derived Hsps like DcHsp70) may be critical for maintaining ATP synthase function during heat stress .

    • Methodological approach: Temperature-dependent activity assays with reconstituted complexes containing wild-type or modified subunit b can reveal its contribution to thermal stability.

  • Regulation of ATP/ADP Ratio During Metabolic Stress:

    • Under conditions of energy limitation or oxidative stress, precise regulation of ATP synthesis becomes critical.

    • The structural integrity of the peripheral stalk, including subunit b, ensures that ATP synthase can respond appropriately to changes in proton motive force during stress conditions.

    • Methodological approach: Measurement of ATP synthesis rates in isolated chloroplasts under various stress conditions, comparing systems with normal versus altered subunit b expression.

  • Protective Mechanisms Against Oxidative Damage:

    • Research indicates that polyacetylenes from Daucus carota can affect cellular ATP levels and activate protective pathways like NRF2, suggesting complex interactions between ATP synthase function and stress response pathways .

    • The ATP synthase complex may be both a target of oxidative damage and part of the adaptive response.

    • Methodological approach: Assessment of reactive oxygen species (ROS) production and oxidative damage to ATP synthase components, including subunit b, under stress conditions using redox proteomics approaches.

  • Coordination with Nuclear-Encoded Components:

    • Environmental stresses require coordinated expression of plastid-encoded (like atpF) and nuclear-encoded ATP synthase components.

    • Research in other species has identified nuclear factors like MDE1 that regulate chloroplast-encoded ATP synthase components, suggesting similar mechanisms may exist in Daucus carota .

    • Methodological approach: Transcriptomic and proteomic analyses to identify coordinated expression patterns between nuclear and chloroplast genes encoding ATP synthase components under different stress conditions.

Understanding these adaptive mechanisms not only illuminates fundamental aspects of plant bioenergetics but also provides potential targets for engineering stress-tolerant crops with improved energy efficiency.

How can CRISPR-Cas9 gene editing be optimized for studying the function of the ATP synthase subunit b in Daucus carota?

Optimizing CRISPR-Cas9 gene editing for studying ATP synthase subunit b (atpF) in Daucus carota requires careful consideration of several technical and biological factors:

  • Targeting Strategy for Chloroplast Genome Editing:

    • The atpF gene is located in the chloroplast genome, requiring chloroplast-specific CRISPR-Cas9 systems rather than conventional nuclear genome editing approaches.

    • Optimization approach: Develop chloroplast-targeted Cas9 by fusing a chloroplast transit peptide to the Cas9 protein, or utilize direct biolistic transformation of chloroplast-specific CRISPR-Cas9 constructs .

    • Multiple guide RNAs should be designed targeting different regions of the atpF gene to increase editing efficiency, with careful consideration of chloroplast genome-specific PAM requirements.

  • Guide RNA Design Considerations:

    • Guide RNA design must account for the high AT content typical of chloroplast genomes and the unique sequence features of the atpF gene.

    • Optimization table for gRNA selection:

    ParameterOptimal CharacteristicsValidation Method
    GC content40-60%In silico prediction tools
    Off-target potentialMinimal homology to other chloroplast genesWhole chloroplast genome sequencing
    Target regionFunctional domains or splice sitesProtein structure analysis
    PAM accessibilityExposed in chloroplast nucleoid structureDNase I hypersensitivity assays
    Secondary structureMinimal self-complementarityRNA folding prediction algorithms
  • Delivery Methods for Daucus carota Tissues:

    • Efficient transformation of carrot tissues requires optimization of delivery systems.

    • Comparative evaluation of delivery methods:

      • Biolistic bombardment: Most effective for direct chloroplast transformation

      • Agrobacterium-mediated: Suitable for nuclear-encoded components

      • PEG-mediated transformation of protoplasts: Allows for transient expression studies

    • For each method, parameters such as DNA concentration, osmotic conditions, and recovery media composition must be optimized specifically for carrot tissues .

  • Phenotypic Characterization of Edited Plants:

    • Based on findings in Chlamydomonas reinhardtii, atpF knockout mutations would likely prevent ATP synthase function and accumulation .

    • Comprehensive phenotyping approach:

      • Photosynthetic parameters (oxygen evolution, chlorophyll fluorescence)

      • Growth measurements under different light conditions

      • ATP/ADP ratio determination in chloroplasts

      • Proteomic analysis of ATP synthase complex assembly

      • Electron microscopy to assess thylakoid structure

  • Generation of Partial Function Mutants:

    • Complete knockout of atpF may be lethal or severely impact viability, necessitating strategies for creating partial function mutations.

    • Methodological solutions:

      • Base editing rather than double-strand break repair to introduce specific amino acid changes

      • Inducible expression systems to control the timing of modification

      • Creation of heteroplasmic plants with mixed wild-type and edited chloroplast populations

      • Complementation with modified versions of atpF to study structure-function relationships

  • Validation Strategies:

    • Confirming successful editing and excluding off-target effects is critical.

    • Validation protocol:

      • Deep sequencing of the target region

      • Western blotting for ATP synthase subunit b protein

      • Blue-native PAGE to assess complex assembly

      • Complementation with wild-type atpF to confirm phenotype causality

By implementing these optimized CRISPR-Cas9 approaches, researchers can generate valuable insights into the function of ATP synthase subunit b in Daucus carota, advancing our understanding of chloroplast bioenergetics and potentially contributing to crop improvement strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.