Recombinant Daucus carota Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Daucus carota Chloroplast Envelope Membrane Protein (cemA)

The chloroplast envelope membrane protein (cemA) is a critical component of plant chloroplast membranes, playing roles in maintaining membrane integrity and facilitating processes such as proton extrusion and inorganic carbon uptake. In Daucus carota (carrot), recombinant cemA (rDc-cemA) has been produced for research purposes, enabling studies on chloroplast function, membrane dynamics, and biotechnological applications. This recombinant protein is typically expressed in Escherichia coli and purified for structural or functional analyses .

Expression and Production of Recombinant cemA

rDc-cemA is synthesized via heterologous expression in E. coli systems. Key production parameters include:

ParameterDetails
Source OrganismDaucus carota (Carrot)
Expression SystemE. coli
TagDetermined during production*
LengthFull-length (1–229 amino acids)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C/-80°C (avoid repeated freeze-thaw cycles)

*The tag type (e.g., His-tag, Strep-tag) is optimized during production to ensure proper folding and purification .

Applications in Research and Biotechnology

Recombinant cemA serves as a valuable tool for:

  1. Chloroplast Membrane Studies: Investigating protein localization and interactions.

  2. Structural Biology: Crystallization and X-ray crystallography to resolve 3D structures.

  3. Biotechnological Engineering: Modifying chloroplast membrane properties for enhanced photosynthesis or stress tolerance.

Research Findings and Challenges

Current data highlight successful production and characterization of rDc-cemA, including:

  • Purification Efficiency: Achieved via optimized protocols, though exact purity metrics remain unspecified .

  • Stability: Robust storage in glycerol-based buffers ensures long-term viability .

  • Gaps: Functional assays (e.g., proton transport assays) are pending to validate inferred roles.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
cemA
Target Protein Sequence
MSKKKAFTSLLYLASIVFLPWWISLSFNKSLESWVTDWWNTRQSEIFWNDIQEKNIIKNF IELEEILLLEEMIKEDSETHLQNLRIGIHKETLQLIKIHNEDHIHTILHFSTNIICFVIL SGYSILGNEELVILNSWAQEFIYNLSDTIKAFWILLLTDFFIGFHSTRGWELMIGFVYKD FGFAHNDQILSSLVCIFPVILDTLFKFWVFRYLNCVSPSLVVIYHSMNE
Uniprot No.

Target Background

Function
May be involved in proton extrusion. Indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are currently used for recombinant production of Daucus carota cemA protein?

Recombinant cemA protein from Daucus carota can be produced using several expression systems, with plant-based platforms showing particular promise. Agrobacterium tumefaciens-mediated transformation has been successfully employed for generating transgenic carrot plants expressing recombinant proteins . This approach has demonstrated efficiency in producing other recombinant proteins in carrots with proper folding and biological activity. The methodology typically involves:

  • Cloning the cemA gene under the control of appropriate promoters

  • Transformation of carrot cells using Agrobacterium tumefaciens

  • Selection of transformed cells and regeneration of transgenic plants

  • Verification of transgene integration via Southern blot and expression confirmation via RT-PCR

  • Protein extraction and purification from carrot tissue

This plant-based expression system is particularly valuable for producing properly folded membrane proteins that retain their native conformation and functionality.

How can researchers verify successful expression of recombinant cemA protein in transformed carrot cells?

Verification of successful cemA expression requires a multi-step analytical approach:

  • Genomic integration: Southern blot analysis to confirm transgene incorporation and determine copy number in the plant genome .

  • Transcriptional activity: RT-PCR using cemA-specific primers to verify active transcription of the target gene in transformed tissues .

  • Protein detection: Western blot analysis using anti-cemA antibodies, typically targeting the membrane fraction of cell extracts. For membrane proteins like cemA, specialized extraction protocols using chloroform/methanol, alkaline treatments, or saline treatments may be necessary to solubilize the protein efficiently .

  • Subcellular localization: Fluorescence microscopy using GFP-fusion constructs to confirm chloroplast envelope localization. This approach has been successfully employed for other chloroplast-targeted proteins in transgenic plants .

  • Functional assessment: Biochemical assays specific to the predicted function of cemA, which may include transport or enzymatic activity measurements.

What purification strategies are most effective for isolating recombinant cemA protein from Daucus carota while maintaining protein integrity?

Purifying membrane proteins like cemA presents significant challenges due to their hydrophobic nature and integration within lipid bilayers. Based on established protocols for chloroplast envelope proteins, the following multi-phase approach is recommended:

  • Chloroplast isolation: Develop a procedure to obtain highly purified chloroplasts from transformed carrot tissues using density gradient centrifugation.

  • Envelope membrane separation: Isolate envelope membranes through osmotic shock treatment followed by sucrose gradient centrifugation to separate envelope fractions from thylakoid membranes.

  • Protein extraction: Apply multiple extraction methods sequentially to maximize recovery:

    • Chloroform/methanol extraction for highly hydrophobic domains

    • Alkaline treatment (pH 11.5) to release peripheral membrane proteins

    • Saline treatment to extract proteins with ionic interactions

  • Chromatographic purification: Employ a combination of:

    • Immobilized metal affinity chromatography (if His-tagged)

    • Ion exchange chromatography

    • Size exclusion chromatography in the presence of appropriate detergents

  • Detergent screening: Test a panel of detergents (n-dodecyl-β-D-maltoside, digitonin, CHAPS) to identify optimal solubilization conditions that maintain native protein conformation.

The validation of protein integrity should include conformational analysis, potentially using circular dichroism or limited proteolysis to ensure the purified protein maintains its structural properties.

How can researchers optimize transformation protocols specifically for cemA expression in Daucus carota?

Optimizing transformation protocols for cemA expression requires strategic modifications to standard Agrobacterium-mediated transformation approaches:

  • Promoter selection: For tissue-specific expression, the polygalacturonase (PG) promoter from Solanum chilense has demonstrated efficacy in directing expression to fruit tissues . For constitutive expression in carrot, the CaMV 35S promoter or ubiquitin promoters may be more suitable.

  • Codon optimization: Adjust the cemA coding sequence to match Daucus carota codon usage preferences, potentially increasing expression efficiency by 2-3 fold.

  • Targeting sequences: Incorporate appropriate chloroplast transit peptides to ensure proper localization if using nuclear transformation. Alternatively, chloroplast transformation may provide more direct targeting.

  • Transformation methodology: Direct somatic embryogenesis has proven rapid and efficient for carrot transformation . The protocol involves:

    • Preparing explants from carrot taproot or leaf tissue

    • Co-cultivation with Agrobacterium carrying the cemA construct

    • Selection on media containing appropriate antibiotics

    • Regeneration through somatic embryogenesis

    • Verification of transgenic status

  • Expression enhancement: Consider including introns or 5' UTR elements that have been shown to enhance transgene expression in carrots.

For monitoring transformation efficiency, employing a dual reporter system with a visual marker like GFP alongside cemA can facilitate rapid identification of successfully transformed tissues .

What are the critical factors affecting the structural integrity and functionality of recombinant cemA protein when expressed in heterologous systems?

Several critical factors influence the structural integrity and functionality of recombinant cemA:

  • Post-translational modifications: Chloroplast envelope proteins may undergo Nα-acetylation, which identifies the accurate N-terminus of the mature protein . Ensuring proper post-translational processing in heterologous systems is essential for maintaining protein function.

  • Membrane integration: As an integral membrane protein, cemA requires proper insertion into the lipid bilayer. Expression systems must provide appropriate machinery for membrane protein insertion and folding.

  • Protein folding environment: The chloroplast envelope presents a unique lipid composition and protein folding environment. Heterologous systems should ideally mimic these conditions or accommodate proper folding of cemA.

  • Potential proteolysis: Protection against degradation by host proteases is crucial. Co-expression with protease inhibitors or optimization of extraction conditions to minimize proteolytic activity may be necessary.

  • Oligomerization state: If cemA functions as part of a complex, its proper assembly and stability in the absence of partner proteins must be considered.

A comparative analysis of cemA expressed in different systems (bacterial, yeast, plant-based) can help identify the optimal expression platform that maintains structural and functional integrity.

How can researchers effectively study the transport function of cemA protein in reconstituted systems?

Studying the transport function of cemA protein requires sophisticated methodology:

  • Liposome reconstitution: Purified cemA can be incorporated into liposomes of defined lipid composition mimicking the chloroplast envelope. This system allows for controlled assessment of transport activity across membranes.

  • Electrophysiological measurements: Planar lipid bilayer experiments or patch-clamp techniques applied to proteoliposomes can characterize ion channel or transporter activity of reconstituted cemA.

  • Flux assays: Developing assays that measure the movement of potential substrates across membranes containing reconstituted cemA. This may involve:

    • Loading liposomes with fluorescent indicators sensitive to ions or metabolites

    • Isotope labeling to track movement of substrates

    • Stopped-flow spectroscopy to measure rapid transport kinetics

  • Mutational analysis: Systematic mutation of key residues in the cemA sequence can identify domains critical for substrate recognition and transport activity.

  • Inhibitor studies: Screening potential inhibitors of cemA transport function can provide valuable tools for functional characterization and potentially reveal physiological roles.

For rigorous functional analysis, comparing wild-type cemA with site-directed mutants in these reconstituted systems can establish structure-function relationships for this membrane protein.

What roles might cemA play in chloroplast development and plant stress responses?

The involvement of cemA in chloroplast development and stress responses can be investigated through multiple experimental approaches:

  • Gene silencing/knockout studies: CRISPR/Cas9-mediated knockout or RNAi-based silencing of cemA in carrots can reveal developmental and physiological consequences of reduced cemA function.

  • Expression analysis: Quantitative assessment of cemA expression under various stress conditions (drought, salt, temperature, oxidative stress) to determine if its regulation correlates with stress response mechanisms.

  • Protein interaction networks: Identifying cemA interaction partners through techniques such as:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening with soluble domains

    • Split-GFP complementation assays for in vivo interaction validation

  • Metabolomic profiling: Comparative metabolomic analysis of wild-type and cemA-modified plants can reveal metabolic pathways affected by cemA function.

Evidence from other chloroplast envelope proteins suggests possible involvement in cellular responses to oxidative stress , making this a particularly promising avenue for investigation in the context of cemA function.

What are the comparative differences in cemA protein structure and function across different plant species?

Understanding the evolutionary conservation and divergence of cemA requires comparative analysis:

This comparative approach can reveal if cemA functions are conserved or if they have diverged to meet species-specific physiological requirements.

How can researchers overcome expression challenges when working with recombinant cemA protein?

Membrane proteins like cemA present specific expression challenges that can be addressed through strategic approaches:

ChallengeSolution ApproachExpected Outcome
Low expression levelsTest multiple promoters (35S, ubiquitin, tissue-specific)Identify optimal expression control elements
Protein misfoldingCo-express with molecular chaperonesImproved folding and reduced aggregation
Toxicity to host cellsUse inducible expression systemsControlled expression minimizing cellular stress
Improper localizationOptimize transit peptide sequenceEnhanced targeting to chloroplast envelope
Post-translational processingSelect appropriate expression hostProper protein maturation and modification
Protein degradationInclude protease inhibitors during extractionReduced degradation during purification
Extraction efficiencyTest multiple detergent combinationsOptimized solubilization while maintaining structure

Additionally, researchers can consider alternative expression strategies such as cell-free systems for difficult-to-express membrane proteins or split-protein approaches that express hydrophilic domains separately from membrane-spanning regions .

What analytical methods are most appropriate for characterizing the interaction of cemA with other chloroplast envelope proteins?

Characterizing protein-protein interactions involving membrane proteins requires specialized approaches:

  • Crosslinking mass spectrometry: Chemical crosslinking followed by proteomic analysis can capture transient interactions between cemA and partner proteins within the native membrane environment.

  • Blue native PAGE: This technique preserves protein complexes during electrophoresis, allowing identification of cemA-containing multiprotein assemblies in the chloroplast envelope.

  • Förster resonance energy transfer (FRET): For in vivo analysis, cemA and potential partners can be tagged with fluorescent proteins to measure proximity-based energy transfer.

  • Surface plasmon resonance (SPR): Using purified components, SPR can provide quantitative binding kinetics between cemA and soluble interaction partners or fragments.

  • Hydrogen-deuterium exchange mass spectrometry: This approach can map interaction interfaces by identifying regions of cemA that show protection from deuterium exchange when bound to partners.

  • Co-evolution analysis: Computational identification of co-evolving residues between cemA and other chloroplast proteins can predict interaction interfaces.

For comprehensive interaction mapping, a combination of these methods is recommended, with validation through functional assays that assess the physiological relevance of identified interactions.

What are the best approaches for studying cemA protein dynamics and turnover in plant cells?

Understanding the dynamics and turnover of cemA requires tracking its behavior from synthesis to degradation:

  • Pulse-chase experiments: Using inducible promoters and metabolic labeling to track cemA synthesis, maturation, and degradation rates.

  • Fluorescent protein fusions: Creating cemA-GFP fusions under native promoters to monitor localization, movement, and turnover through live-cell imaging.

  • Turnover analysis: Treating plants with protein synthesis inhibitors (cycloheximide) to determine cemA half-life under various conditions.

  • Ubiquitination analysis: Immunoprecipitation followed by ubiquitin-specific western blot to assess if cemA undergoes ubiquitin-mediated degradation.

  • Conditional degradation systems: Engineering cemA with degron tags that allow controlled destabilization to study cellular responses to rapid cemA depletion.

  • Selective permeabilization assays: Using detergents that differentially permeabilize cellular membranes to assess cemA topology and accessibility to proteases.

These approaches can reveal how cemA levels are regulated during development and in response to environmental conditions, providing insight into its physiological importance.

How might cemA be utilized in chloroplast engineering for improved photosynthetic efficiency?

Chloroplast engineering targeting cemA offers several potential approaches for enhancing photosynthetic efficiency:

  • Metabolite transport optimization: If cemA functions in metabolite transport across the chloroplast envelope, its overexpression or engineering might enhance the flux of photosynthetic intermediates, potentially increasing carbon fixation rates.

  • Stress resistance enhancement: Engineering cemA variants with improved stability under stress conditions could contribute to maintaining chloroplast function during environmental challenges.

  • Transgenic complementation studies: Introducing modified cemA variants into plants with identified envelope transport limitations could reveal bottlenecks in photosynthetic metabolism.

  • Synthetic biology approaches: Creating chimeric proteins combining functional domains of cemA with other transporters could generate novel activities supporting enhanced photosynthetic flux.

  • Interaction with carbon concentrating mechanisms: Investigating if cemA could support components of carbon concentrating mechanisms being engineered into C3 plants from C4 or CAM species.

The development of high-throughput screening methods for cemA variants with enhanced properties will be crucial for realizing these applications.

What methodological advances are needed to better understand the structure-function relationship of cemA?

Advancing our understanding of cemA structure-function relationships requires methodological innovations:

  • Cryo-electron microscopy optimization: Adapting single-particle cryo-EM approaches for smaller membrane proteins like cemA could revolutionize our structural understanding.

  • Native mass spectrometry: Developing improved methods for analyzing membrane proteins in native-like lipid environments to determine oligomeric states and lipid interactions.

  • In-cell NMR approaches: Adapting nuclear magnetic resonance techniques to study cemA dynamics within intact cells.

  • Improved reconstitution systems: Developing nanodiscs or other membrane mimetics that better replicate the unique lipid composition of the chloroplast envelope.

  • Computational integration: Combining molecular dynamics simulations with experimental constraints to model cemA behavior in membrane environments.

  • High-throughput mutagenesis: CRISPR-based saturation mutagenesis coupled with functional screens to comprehensively map functional domains.

These methodological advances would significantly enhance our ability to connect cemA sequence, structure, and function.

How could cemA research contribute to developing stress-tolerant crop varieties?

The potential applications of cemA research for crop improvement include:

  • Abiotic stress tolerance: Identifying cemA variants from stress-tolerant wild relatives of carrot or other species could provide genetic resources for enhancing crop resilience to environmental stresses.

  • Metabolic engineering platforms: Using the understanding of cemA function to design improved metabolite transport systems in chloroplasts, potentially enhancing photosynthetic efficiency under stress conditions.

  • Marker-assisted breeding: Developing molecular markers based on cemA sequence variation to select for improved stress tolerance traits in breeding programs.

  • Climate adaptation strategies: Characterizing how cemA function adapts to different environmental conditions could inform crop development for changing climates.

  • Transgenic approaches: Engineering optimized cemA variants could be incorporated into multigene strategies for developing climate-resilient crops.

The integration of cemA research into broader chloroplast engineering efforts represents a promising approach for addressing agricultural challenges associated with climate change.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.