Recombinant Daucus carota Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPVGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does subunit IV (petD) play in photosynthetic organisms?

The cytochrome b6-f complex is a crucial multiprotein complex involved in the electron transport chain during photosynthesis. It serves as a key intermediary between photosystems II and I, facilitating electron transfer and contributing to the generation of a proton gradient across the thylakoid membrane. The complex consists of several protein subunits, including cytochrome f, cytochrome b6, the Rieske iron-sulfur protein, and subunit IV (encoded by the petD gene) .

Subunit IV plays a critical structural and functional role within the cytochrome b6-f complex. It contains transmembrane helices that contribute to the architecture of the complex and is essential for its proper assembly and function. RNA analysis of mutants indicates that the chloroplast gene for subunit IV (petD) undergoes normal transcription and processing even in mutants lacking the complex . Research has demonstrated that subunit IV has specific functional domains, including regions extending from the PEWY motif to the C-terminal, comprising helices F and G, which are important targets for mutagenesis studies investigating protein-protein interactions .

Furthermore, experimental evidence suggests that subunit IV is involved in state transitions, a mechanism by which photosynthetic organisms balance energy distribution between photosystems. Specific amino acid residues, such as Arg125 in subunit IV, have been identified as being involved in the activation of Stt7 kinase, which is crucial for state transitions .

How can researchers effectively express and purify recombinant Daucus carota cytochrome b6-f complex subunit 4 (petD) for functional studies?

Expression and purification of recombinant cytochrome b6-f complex proteins, including subunit IV from Daucus carota, typically utilize bacterial expression systems, particularly E. coli. While the search results do not specifically detail the expression of Daucus carota petD, the methodologies employed for other Daucus carota recombinant proteins provide valuable insights that can be adapted .

The expression process generally involves:

  • Gene cloning: The petD gene sequence is cloned into a suitable expression vector, often incorporating an N-terminal His-tag to facilitate purification, as seen with other Daucus carota recombinant proteins .

  • Expression conditions: Transformation into an E. coli expression strain, followed by induction of protein expression under optimized temperature, duration, and inducer concentration conditions.

  • Protein purification: Typically performed using affinity chromatography with the His-tag, followed by size exclusion chromatography if higher purity is required.

  • Quality assessment: The purity is determined by SDS-PAGE under reducing conditions and visualized by Coomassie blue staining, with a target purity of >95% .

  • Formulation: The purified protein is typically supplied as a filtered solution in a physiological buffer such as PBS (pH 7.4) and stored at -20°C to maintain stability .

For functional studies, it is important to verify that the recombinant protein maintains its native conformation and activity. This may require additional characterization steps, such as circular dichroism spectroscopy or functional assays specific to the cytochrome b6-f complex.

What are the key structural features of Daucus carota cytochrome b6-f complex subunit IV that differentiate it from other plant species?

While the search results do not provide specific comparative structural information for Daucus carota petD versus other plant species, general structural features of cytochrome b6-f complex subunit IV can be inferred from the available data on the complex's architecture and function .

Subunit IV of the cytochrome b6-f complex typically contains:

  • Transmembrane helices: The protein includes multiple transmembrane domains that anchor it within the thylakoid membrane, including helices F and G as mentioned in the research .

  • The PEWY motif: This conserved sequence is important for the function of the complex, particularly in relation to the Q₀ site which binds plastoquinol (PQH₂) .

  • Stromal domain: Research indicates that subunit IV contains stromal regions that interact with other proteins, notably Stt7 kinase. In particular, Arg125 in the stromal region has been identified as involved in Stt7 activation .

  • Species-specific variations: While core functional regions are likely conserved across species, subtle variations in amino acid sequences may exist that could confer species-specific properties or interactions.

To precisely identify the unique structural features of Daucus carota cytochrome b6-f complex subunit IV, researchers would need to perform comparative sequence analysis with homologs from other plant species, followed by structural modeling or experimental structure determination using techniques such as X-ray crystallography or cryo-electron microscopy.

How does the interaction between cytochrome b6-f complex subunit IV and Stt7 kinase regulate state transitions in photosynthesis?

The interaction between cytochrome b6-f complex subunit IV and Stt7 kinase represents a sophisticated regulatory mechanism in photosynthetic energy distribution. State transitions allow photosynthetic organisms to balance energy between photosystems I and II in response to changing light conditions, and this process is regulated by the redox state of the plastoquinone (PQ) pool .

Current research indicates that this regulatory pathway involves several key components:

  • The redox sensing mechanism: The cytochrome b6-f complex with a functional Q₀ site and plastoquinol (PQH₂) binding are required for Stt7 activation . When the PQ pool becomes reduced, it triggers a signaling cascade.

  • Cross-membrane signaling: Despite the Stt7 kinase domain and its substrates (LHCII) being located on the stromal side of the thylakoid membrane, the initial signal originates from PQH₂ binding at the lumenal Q₀ site . This necessitates a cross-membrane signal transduction mechanism.

  • Direct protein-protein interactions: Research demonstrates that cytochrome b6-f and Stt7 interact directly through both lumenal and stromal domains. The lumenal domain of Stt7 interacts with the Rieske iron-sulfur protein subunit of cytochrome b6-f and contains two conserved cysteine residues that may be involved in redox sensing .

  • Role of subunit IV: Critically, experimental evidence identifies Arg125 in the stromal region of subunit IV as involved in Stt7 activation . This suggests that this amino acid residue may participate in the direct interaction with Stt7's kinase domain or influence its activation through allosteric effects.

  • Phosphorylation events: During PQ pool reduction, the PetO subunit of cytochrome b6-f is phosphorylated by Stt7 , likely representing an important step in the signaling cascade.

What experimental approaches are most effective for studying the functional domains of recombinant Daucus carota petD in photosynthetic electron transport?

Investigating the functional domains of recombinant Daucus carota petD requires a multi-faceted experimental approach that combines genetic, biochemical, and biophysical techniques. Based on the current literature, the following methodologies have proven effective:

  • Random and site-directed mutagenesis: Error-prone PCR for random mutagenesis of specific regions of the petD gene has been successfully employed to probe potential interaction sites . This approach allows researchers to target specific domains, such as the region from the PEWY motif to the C-terminal, comprising helices F and G . For Daucus carota, this would involve:

    • Design of appropriate primers to amplify the target region

    • Optimization of error-prone PCR conditions

    • Screening of mutant libraries for functional phenotypes

  • Chloroplast transformation: For in vivo studies, transformation of the chloroplast genome to introduce modified petD variants is essential . This allows for the assessment of the physiological relevance of specific amino acid residues or domains in the natural cellular context.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid assays, or more advanced methods like bimolecular fluorescence complementation can be employed to study the interaction between subunit IV and other proteins, particularly Stt7 kinase .

  • Functional assays for electron transport: Measurements of electron transport rates, proton gradient formation, and state transitions in systems with wild-type versus mutant petD provide direct evidence of functional consequences. These can include:

    • Oxygen evolution/consumption measurements

    • Chlorophyll fluorescence analysis

    • Spectroscopic assessment of electron carrier redox states

  • Structural analysis: Techniques such as X-ray crystallography or cryo-electron microscopy can provide atomic-level insights into how mutations affect the structure and potentially the function of the cytochrome b6-f complex.

A particularly effective approach demonstrated in the literature is the combination of random mutagenesis with in vivo screening for impaired state transitions, which has successfully identified functional residues such as Arg125 in subunit IV that are involved in Stt7 activation .

How do mutations in the Daucus carota petD gene affect the assembly and stability of the cytochrome b6-f complex?

Research on a mutant of Lemna perpusilla (duckweed) provides valuable insights into how defects in cytochrome b6-f complex subunits affect assembly. This mutant contained less than 1% of the four protein subunits of the complex compared to wild-type . Key findings include:

  • Impact on protein stability: Immunoprecipitation of in vivo labeled proteins indicated that while both cytochrome f and subunit IV are synthesized in the mutant, subunit IV shows a 10-fold higher rate of protein turnover . This suggests that mutations affecting complex assembly can drastically increase the degradation rate of individual subunits.

  • Transcription vs. translation: RNA gel blot analyses indicated that the chloroplast genes for cytochrome f, cytochrome b6, and subunit IV (petA, petB, and petD, respectively) are transcribed and undergo normal processing even in mutants lacking the complex . This highlights that assembly defects often occur post-transcriptionally.

  • Coordinated assembly: The data suggest that the assembly of the cytochrome complex involves coordinated synthesis and stability of multiple subunits . When one component is defective or missing, others may be synthesized but rapidly degraded.

For Daucus carota specifically, researchers studying the petD gene would need to consider:

  • Specific domains critical for assembly: The regions extending from the PEWY motif to the C-terminal, comprising helices F and G, are potential targets for mutagenesis studies . Mutations in these regions might particularly affect complex assembly and stability.

  • Methodological approaches: Assembly defects can be assessed using techniques such as:

    • Blue native PAGE to analyze intact complexes

    • Pulse-chase experiments to measure protein turnover rates

    • Immunoblotting to quantify steady-state levels of individual subunits

    • Electron microscopy to visualize complex formation

  • Functional consequences: Mutations affecting assembly would likely impair electron transport and state transitions, which could be measured through chlorophyll fluorescence and other biophysical techniques.

What are the current methodologies for assessing the role of specific amino acid residues in petD function, particularly those involved in protein-protein interactions?

Investigating the role of specific amino acid residues in petD function, especially those involved in protein-protein interactions, requires sophisticated methodological approaches. Based on the literature, the following methodologies are currently employed:

  • Site-directed mutagenesis combined with functional screening:

    • Strategic substitution of targeted amino acid residues based on sequence conservation analysis or structural predictions

    • Expression of mutant variants in appropriate host systems

    • Screening for functional impacts using phenotypic assays, such as state transition measurements

  • Random mutagenesis approaches:

    • Error-prone PCR for the generation of mutation libraries in specific regions of interest, such as the region from the PEWY motif to the C-terminal of subunit IV

    • Chloroplast transformation for in vivo expression of mutant variants

    • High-throughput screening approaches to identify functionally important residues

  • Protein-protein interaction analysis:

    • Direct assessment of interactions between wild-type or mutant petD and partner proteins (e.g., Stt7 kinase) using techniques such as:

      • Co-immunoprecipitation

      • Surface plasmon resonance

      • Förster resonance energy transfer (FRET)

      • Bimolecular fluorescence complementation

  • Structural biology approaches:

    • X-ray crystallography or cryo-electron microscopy to determine atomic-level structures

    • Molecular dynamics simulations to predict the effects of mutations on protein structure and dynamics

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in protein-protein interactions

  • In vivo functional validation:

    • Generation of transgenic plants expressing mutant petD variants

    • Assessment of photosynthetic parameters under different light conditions

    • Analysis of state transitions and electron transport efficiency

A particularly effective approach demonstrated in the literature combines random mutagenesis with in vivo screening for impaired state transitions. This strategy successfully identified Arg125 in the stromal region of subunit IV as involved in Stt7 activation . The method involved:

  • Error-prone PCR for mutagenesis of the petD gene

  • Transformation of the chloroplast genome with mutant variants

  • Screening for impaired state transitions in vivo

  • Sequencing of petD variants to identify the mutations

  • Verification that cytochrome b6-f and Stt7 interact directly through their stromal domains

  • Confirmation of the role of specific residues (e.g., Arg125) in Stt7 activation

This comprehensive approach allows for the identification of functionally important residues and the characterization of their specific roles in protein-protein interactions and photosynthetic processes.

What expression systems are optimal for producing functional recombinant Daucus carota cytochrome b6-f complex proteins?

The selection of an appropriate expression system is crucial for obtaining functional recombinant cytochrome b6-f complex proteins. Based on the search results and general principles of membrane protein expression, the following systems can be considered for Daucus carota cytochrome b6-f complex proteins:

  • Bacterial expression systems (E. coli):

    • Common and economical choice, as evidenced by its use for other Daucus carota recombinant proteins

    • Advantages: Rapid growth, high protein yields, well-established protocols

    • Limitations: May lack post-translational modifications, potential for improper folding of membrane proteins

    • Optimization strategies:

      • Use of specialized E. coli strains designed for membrane protein expression

      • Expression at lower temperatures (16-20°C) to improve folding

      • Inclusion of molecular chaperones to assist folding

      • Use of solubility-enhancing tags

  • Chloroplast-based expression systems:

    • Given the native location of cytochrome b6-f complex in chloroplasts, these systems might provide a more suitable environment

    • Transformation of chloroplasts has been successfully employed for studying petD variants

    • Advantages: Natural environment for protein folding and assembly, contains necessary cofactors

    • Limitations: Lower yields, more technically challenging

  • Cell-free expression systems:

    • Allow for direct synthesis of the protein in a controlled environment

    • Particularly useful for membrane proteins that might be toxic to host cells

    • Advantages: Rapid production, ability to incorporate unnatural amino acids

    • Limitations: Higher cost, potentially lower yields

  • Yeast expression systems (P. pastoris or S. cerevisiae):

    • Alternative eukaryotic hosts with machinery for membrane protein folding

    • Advantages: Post-translational modifications, ability to scale up

    • Limitations: Longer expression times, potentially different membrane composition

Based on the successful expression of other Daucus carota recombinant proteins, E. coli appears to be a practical starting point, using an N-terminal His-tag for purification . The purified protein can be supplied as a filtered solution in PBS (pH 7.4) and stored at -20°C .

For functional studies requiring assembled cytochrome b6-f complex, chloroplast-based systems might be more appropriate, despite their technical challenges, as they provide the natural environment for complex assembly and function.

How can researchers effectively design mutation studies to investigate the structure-function relationship of Daucus carota petD?

Designing effective mutation studies to elucidate the structure-function relationship of Daucus carota petD requires a strategic approach combining computational predictions, evolutionary analysis, and experimental validation. Based on the literature, the following comprehensive methodology is recommended:

  • Preliminary sequence and structural analysis:

    • Multiple sequence alignment of petD sequences across species to identify conserved residues

    • Homology modeling based on existing crystal structures of cytochrome b6-f complex

    • Computational prediction of functional domains and protein-protein interaction sites

    • Identification of key regions, such as the area from the PEWY motif to the C-terminal, comprising helices F and G

  • Target selection strategies:

    • Focus on highly conserved residues, which often indicate functional importance

    • Prioritize residues in predicted interaction interfaces with partners like Stt7 kinase

    • Consider residues in the stromal domain that might be involved in signal transduction

    • Target specific motifs known to be important for function, such as the PEWY motif

  • Mutagenesis approaches:

    • Site-directed mutagenesis for specific hypothesis testing:

      • Conservative substitutions to assess the importance of specific chemical properties

      • Charge inversions to disrupt potential electrostatic interactions

      • Alanine scanning to neutralize side chain contributions

    • Random mutagenesis for unbiased identification of functional residues:

      • Error-prone PCR targeting specific regions, as demonstrated in the literature

      • Creation of mutation libraries with varying degrees of coverage

  • Expression systems:

    • In vitro systems for biochemical and biophysical characterization

    • Chloroplast transformation for in vivo functional studies

    • Heterologous expression in model organisms for specific assays

  • Functional assessment:

    • State transition assays to evaluate the impact on photosynthetic energy distribution

    • Protein-protein interaction assays to assess binding to partners like Stt7

    • Electron transport measurements to evaluate effects on photosynthetic function

    • Structural stability assessments to determine effects on complex assembly

  • Data integration and model refinement:

    • Correlation of mutation effects with structural models

    • Refinement of interaction models based on experimental data

    • Iterative approach to test predictions generated from initial rounds of mutations

The literature demonstrates the effectiveness of combining random mutagenesis with in vivo screening, which successfully identified Arg125 in subunit IV as involved in Stt7 activation . This approach allows for the unbiased identification of functionally important residues, which can then be studied in more detail through targeted mutations and mechanistic investigations.

What are the most reliable techniques for measuring the interaction between recombinant petD and Stt7 kinase in vitro and in vivo?

Understanding the interaction between petD (subunit IV) and Stt7 kinase is critical for elucidating the mechanism of state transitions in photosynthesis. Based on current research, several complementary techniques can be employed to reliably measure this interaction, both in vitro and in vivo:

In Vitro Techniques:

  • Co-immunoprecipitation (Co-IP):

    • Utilizes antibodies against either petD or Stt7 to pull down protein complexes

    • Can confirm direct binding between purified components

    • Requires optimization of buffer conditions to maintain membrane protein interactions

    • Detergent selection is critical for solubilizing membrane proteins while preserving interactions

  • Surface Plasmon Resonance (SPR):

    • Provides quantitative binding kinetics and affinity data

    • Allows real-time monitoring of interactions

    • Can assess how mutations in specific residues (e.g., Arg125 in subunit IV) affect binding parameters

    • Requires immobilization of one partner, typically via a tag, on a sensor chip

  • Isothermal Titration Calorimetry (ITC):

    • Label-free method measuring heat changes upon binding

    • Provides thermodynamic parameters (ΔH, ΔS, ΔG) along with binding affinity

    • Can detect conformational changes associated with binding

    • Challenging for membrane proteins due to high protein concentration requirements

  • Microscale Thermophoresis (MST):

    • Detects changes in thermophoretic mobility upon binding

    • Requires only one labeled component

    • Works with small sample volumes and across a wide affinity range

    • More amenable to membrane protein analysis than traditional methods

In Vivo Techniques:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fusion of complementary fragments of a fluorescent protein to petD and Stt7

    • Fluorescence is reconstituted when the proteins interact

    • Allows visualization of the interaction in its native cellular context

    • Can identify subcellular localization of the interaction

  • Förster Resonance Energy Transfer (FRET):

    • Fusion of donor and acceptor fluorophores to petD and Stt7

    • Energy transfer occurs when proteins interact, measurable by changes in fluorescence

    • Provides spatial information about the interaction (<10 nm resolution)

    • Can be used to monitor dynamic interactions in response to changing conditions

  • Chemical Cross-linking coupled with Mass Spectrometry:

    • Covalently links interacting proteins in their native environment

    • Mass spectrometry identifies the cross-linked peptides

    • Provides information about the precise interaction interface

    • Can detect transient interactions that might be missed by other methods

  • Genetic Approaches:

    • Mutational analysis combined with functional assays (e.g., state transition measurements)

    • Suppressor screens to identify compensatory mutations

    • Split-ubiquitin yeast two-hybrid systems adapted for membrane proteins

Research has demonstrated that cytochrome b6-f and Stt7 interact directly through their stromal domains and that Arg125 in the stromal region of subunit IV is involved in Stt7 activation . This finding was established through a combination of genetic approaches (random mutagenesis of petD) and functional screening (assessing state transitions in vivo), highlighting the value of integrated approaches that combine multiple complementary techniques.

What protocols are recommended for analyzing the impact of petD variants on state transitions in photosynthetic organisms?

Analyzing the impact of petD variants on state transitions requires a comprehensive approach combining genetic manipulation, physiological measurements, and biochemical analyses. Based on the research literature, the following protocols are recommended:

Generation and Verification of petD Variants:

A. Mutagenesis and Transformation:

  • Random mutagenesis using error-prone PCR targeting specific regions of petD, such as the region from the PEWY motif to the C-terminal

  • Site-directed mutagenesis for testing specific hypotheses about amino acid functions

  • Chloroplast transformation for introducing petD variants into the native genomic context

  • Verification of successful transformation and mutation by DNA sequencing

B. Expression Confirmation:

  • RNA analysis to confirm transcription and processing of petD variants

  • Protein expression verification using immunoblotting with antibodies against subunit IV

  • Assessment of complex assembly using blue native PAGE or sucrose gradient centrifugation

Physiological Measurements of State Transitions:

A. Chlorophyll Fluorescence Analysis:

  • Room temperature chlorophyll fluorescence measurements using a PAM fluorometer

  • Protocol for state transition induction:

    • State 1: Illumination with far-red light (>700 nm) to oxidize the PQ pool

    • State 2: Illumination with light preferentially absorbed by PSII (e.g., 480 nm) to reduce the PQ pool

  • Quantification of state transitions:

    • Measurement of Fm (maximum fluorescence) in states 1 and 2

    • Calculation of qT (quenching due to state transitions) using the formula: qT = (Fm₁ - Fm₂)/Fm₁

    • Comparison of qT values between wild-type and petD variants

B. 77K Fluorescence Emission Spectroscopy:

  • Flash-freezing of samples in liquid nitrogen after state 1 or state 2 induction

  • Measurement of fluorescence emission spectra at 77K using excitation at 435 nm

  • Analysis of changes in the ratio of PSI (735 nm) to PSII (685-695 nm) emission peaks

  • Quantitative comparison of state transition amplitude between wild-type and variants

Biochemical and Molecular Analyses:

A. LHCII Phosphorylation Assays:

  • In vivo phosphorylation:

    • Radiolabeling with ³²P-orthophosphate during state transition induction

    • Thylakoid isolation and protein separation by SDS-PAGE

    • Autoradiography to detect phosphorylated LHCII

  • Immunodetection:

    • Use of phosphothreonine-specific antibodies

    • Western blotting of thylakoid proteins after state 1 and state 2 induction

    • Quantification of LHCII phosphorylation levels

B. Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation to assess interaction between Stt7 kinase and petD variants

  • Analysis of the phosphorylation status of PetO subunit, which is phosphorylated by Stt7 during PQ pool reduction

  • Comparison of interaction strength and phosphorylation efficiency between wild-type and variants

Structural Analysis:

A. Modeling and Simulation:

  • Homology modeling of wild-type and variant petD proteins

  • Molecular dynamics simulations to predict structural changes

  • Docking studies to assess potential changes in interaction interfaces

B. Experimental Structure Determination:

  • X-ray crystallography or cryo-electron microscopy of purified complexes (if feasible)

  • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered dynamics

Data Integration and Analysis:

  • Correlation analysis between structural changes, protein interactions, and functional outcomes

  • Statistical analysis to determine significance of observed differences

  • Comprehensive model development integrating all experimental findings

Research has demonstrated the effectiveness of combining random mutagenesis with in vivo screening for impaired state transitions, which successfully identified Arg125 in the stromal region of subunit IV as involved in Stt7 activation . This multi-faceted approach provides a robust framework for analyzing the impact of petD variants on state transitions and elucidating the underlying molecular mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.