Recombinant Daucus carota Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Cytochrome b6 (PetB) Functional Overview

Cytochrome b6 (PetB) is an essential subunit of the cytochrome b₆/f complex (cytb₆f), a dimeric multi-protein assembly critical for photosynthetic electron transport. Key features include:

PropertyDescription
GenepetB (chloroplast-encoded)
Molecular Weight~24 kDa (predicted)
Structural RoleBinds three heme groups; forms core with subunit IV (PetD)
FunctionCatalyzes plastoquinol oxidation, enables proton gradient for ATP synthesis

Recombinant Production of Cytochrome b6

While no Daucus carota-specific PetB production is documented, general recombinant approaches are exemplified by:

Example Recombinant Product (Arabidopsis homolog)

ParameterDetail
Host OrganismEscherichia coli
TagN-terminal His-tag
Amino Acid Range1-215 aa (Full length)
UniProt IDQ1XDE6 (Arabidopsis thaliana)
Expression SystemBacterial (Cost-effective for hydrophobic membrane proteins)

Assembly Factors and Mutant Studies

  • DAC Protein: Required for cytb₆/f assembly in Arabidopsis; interacts directly with PetD .

  • Mutant Phenotypes:

    • Reduced PetD and cytochrome f accumulation in dac mutants .

    • Normal cytochrome b6 levels, indicating post-translational assembly defects .

Research Applications

Available tools for cytb₆/f studies include:

  • Antibodies: Polyclonal anti-PetB antibodies validated for BN-PAGE and Western blot (1:1,000–5,000 dilution) .

  • Complex Analysis: Blue native PAGE resolves intact cytb₆/f complexes (16–22 native kDA subunits) .

Limitations and Future Directions

No species-specific data exist for Daucus carota PetB in the reviewed literature. Current models derive from Arabidopsis, maize, and algae. Recombinant production in carrot would require:

  1. Chloroplast genome editing or heterologous expression.

  2. Optimization for transmembrane protein folding in non-native hosts.

  3. Validation via functional complementation assays.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex, which plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of cytochrome b6 (petB) in photosynthesis?

Cytochrome b6, encoded by the petB gene, is one of the four major subunits that constitute the cytochrome b6/f complex, which plays a pivotal role in the photosynthetic electron transport chain of higher plants, green algae, and cyanobacteria. This multi-subunit complex catalyzes the oxidation of quinols and the reduction of plastocyanin, a process that establishes the proton force required for ATP synthesis. The complex comprises four principal subunits: cytochrome f (encoded by petA), cytochrome b6 (encoded by petB), subunit IV (encoded by petD), and the Rieske iron-sulfur protein (encoded by petC) .

The cytochrome b6 component specifically contains three heme groups and functions as a b-type/c-type cytochrome, facilitating electron transfer during photosynthesis. Within the thylakoid membrane, this protein contributes significantly to the energy conversion processes that power plant metabolism .

What are the structural characteristics of the cytochrome b6 protein in Daucus carota?

In Daucus carota, the cytochrome b6 protein is encoded within the plastid genome, which has been completely sequenced and found to be 155,911 bp in length. The petB gene is among the 115 unique genes present in this genome. The cytochrome b6 protein has an expected molecular weight of approximately 24 kDa and contains characteristic heme-binding domains essential for its electron transport function .

The gene contains an intron, as identified among the 18 intron-containing genes in the carrot plastid genome. This intron must be correctly processed during transcript maturation to produce functional cytochrome b6 protein . Based on comparative analysis with other species, the carrot cytochrome b6 protein likely contains similar structural motifs to those characterized in model organisms such as Chlamydomonas reinhardtii, where two b hemes with alpha bands at 564 nm and midpoint potentials (Em,8) of -84 and -158 mV have been documented .

How does the plastid genome organization in Daucus carota affect petB expression?

The plastid genome of Daucus carota exhibits a typical quadripartite structure consisting of large and small single copy regions (LSC and SSC) separated by two inverted repeat regions (IR). The total genome comprises 136 predicted coding regions, with 115 unique genes and 21 duplicated in the IR regions. Within this organization, the petB gene is located in the single copy region and contains an intron that requires proper splicing for gene expression .

What are the optimal protocols for isolating and purifying recombinant cytochrome b6 from Daucus carota?

While specific protocols for Daucus carota cytochrome b6 isolation are still evolving, researchers can adapt methods successfully employed for other species. A well-established approach involves selective solubilization from thylakoid membranes, followed by sucrose gradient sedimentation and hydroxylapatite chromatography .

For recombinant cytochrome b6 purification from carrot, begin with isolating intact chloroplasts from young leaf tissue using a Percoll gradient. Thylakoid membranes can then be solubilized using a neutral detergent such as Hecameg (6-O-(N-heptylcarbamoyl)-methyl-alpha-D-glycopyranoside) at optimal concentrations determined through preliminary experiments. The solubilized material should undergo sucrose gradient centrifugation (typically 0.1-1.0 M) to separate protein complexes based on size. Final purification via hydroxylapatite chromatography can yield highly purified cytochrome b6/f complex .

Quality assessment should include spectrophotometric analysis to confirm the presence of b-type hemes (typically with alpha bands around 564 nm) and functional assays measuring electron transfer activity from appropriate electron donors to acceptors . Western blotting using specific antibodies against the N-terminal region of cytochrome b6 can provide confirmation of protein identity and purity .

What antibody-based techniques are effective for detecting recombinant cytochrome b6 in Daucus carota?

Polyclonal antibodies raised against the N-terminal region of cytochrome b6 (PetB) have proven effective for detecting this protein in various plant species, including Arabidopsis thaliana, and would likely cross-react with the orthologous protein in Daucus carota. Commercial antibodies, such as the rabbit polyclonal antibody against the KLH-conjugated peptide from Arabidopsis thaliana PetB protein sequence, can be utilized for immunodetection experiments .

For optimal results, Western blot analysis should be performed using a dilution range of 1:1000 to 1:5000 of the primary antibody. Blue native PAGE (BN-PAGE) can also be employed to analyze the intact cytochrome b6/f complex while preserving native protein interactions. This approach is particularly valuable when studying the incorporation of recombinant cytochrome b6 into the complete multi-subunit complex .

When preparing samples, remember that the expected molecular weight of the cytochrome b6 protein is approximately 24 kDa. Proper sample preparation, including thorough membrane solubilization and prevention of protein aggregation, is essential for accurate detection. For recombinant proteins, comparison with wild-type controls is crucial to confirm correct processing and assembly .

How can the petB gene be efficiently cloned and expressed in heterologous systems?

Cloning and expressing the petB gene requires careful consideration of several factors specific to plastid genes. The complete sequence of the Daucus carota plastid genome, including the petB gene, is now available, facilitating precise primer design for PCR amplification. When designing expression constructs, researchers should account for the presence of an intron in the petB gene, which may require the use of a cDNA version for expression in heterologous systems that lack appropriate splicing machinery .

For expression in E. coli or other prokaryotic systems, codon optimization may be necessary given the differing codon usage between plastids and bacteria. Additionally, the hydrophobic nature of cytochrome b6 as a membrane protein necessitates strategies to facilitate proper folding and insertion into membranes, such as the use of solubility tags or specialized E. coli strains designed for membrane protein expression .

For expression within the plastids of Daucus carota itself, plastid transformation techniques have shown promising results. This approach allows for high-level expression of recombinant proteins directly in the organelle where cytochrome b6 naturally functions. Integration of foreign genes can be accomplished using flanking sequences derived from the native carrot plastid genome, while expression can be regulated using endogenous or heterologous promoters and regulatory elements .

What are the advantages of using Daucus carota for recombinant petB expression compared to other expression systems?

Daucus carota offers several distinct advantages as a recombinant protein expression system, particularly for plastid-encoded proteins like cytochrome b6. Carrot's biennial lifecycle and root storage capacity make it an excellent platform for accumulating recombinant proteins in an organ that can be easily harvested, stored, and processed. Recent developments in plastid transformation techniques for carrot have demonstrated the feasibility of expressing foreign proteins in chromoplasts of carrot taproots, with certain proteins showing activity up to 74.8% of leaf tissue levels despite root tissues typically containing only about 5% of the plastome copy number found in mature leaves .

The complete sequencing of the carrot plastid genome provides essential information for designing appropriate flanking sequences and regulatory elements to optimize transformation efficiency and expression levels. The availability of endogenous sequences enables homologous recombination for precise integration into the plastid genome, potentially improving stability and expression compared to heterologous systems .

Furthermore, as an edible crop, carrot has been identified as a promising candidate for the oral delivery of vaccines and therapeutic proteins, offering a potential pathway for applications derived from recombinant cytochrome b6 research. The established protocols for carrot somatic embryogenesis facilitate stable transformation and regeneration of transgenic plants .

How can structural modifications to petB enhance its functionality in recombinant systems?

Strategic modifications to the petB gene sequence can significantly enhance the expression, stability, and functionality of recombinant cytochrome b6 protein. Based on comparative analysis of the protein across species, researchers can identify conserved domains critical for function versus regions that may be modified without compromising activity .

For membrane proteins like cytochrome b6, modifications to hydrophobic regions can improve folding efficiency and stability in recombinant systems. Targeted amino acid substitutions in these regions, guided by molecular dynamics simulations, may enhance integration into thylakoid membranes while maintaining electron transport capabilities. Additionally, introducing affinity tags at non-critical positions can facilitate purification without disrupting function, though care must be taken to ensure such modifications do not interfere with complex assembly .

Another approach involves optimizing the codon usage of the petB gene to match the expression system while preserving key regulatory elements. For plastid expression specifically, modifications to 5' and 3' untranslated regions may enhance translation efficiency. When expressing a recombinant version that must integrate into the multi-subunit cytochrome b6/f complex, preserving interaction domains with other subunits (cytochrome f, Rieske iron-sulfur protein, and subunit IV) is essential .

What methodologies are available for assessing the functional integration of recombinant cytochrome b6 into the photosynthetic apparatus?

Assessing functional integration of recombinant cytochrome b6 into the photosynthetic apparatus requires a multifaceted approach combining biochemical, biophysical, and physiological techniques. Spectroscopic methods provide direct evidence of proper cofactor incorporation and protein folding. Absorption spectroscopy can confirm the presence of characteristic b-type heme groups (alpha bands at approximately 564 nm), while redox potentiometry can verify whether these hemes exhibit appropriate midpoint potentials (-84 and -158 mV for the b hemes in the cytochrome b6/f complex) .

Electron transfer activity assays offer functional assessment of the recombinant protein. A well-established approach involves measuring the rate of electron transfer from decylplastoquinol to oxidized plastocyanin, with properly functioning complexes exhibiting turnover numbers of approximately 250-300 s^-1. This assay directly evaluates the catalytic capability of the cytochrome b6/f complex incorporating the recombinant cytochrome b6 .

What are common challenges in expressing functional petB in recombinant systems and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional petB in recombinant systems. One principal obstacle is the proper folding and membrane insertion of cytochrome b6, as its hydrophobic nature can lead to protein aggregation or misfolding. This can be addressed by co-expressing chaperone proteins, optimizing growth temperatures (typically lowering to 18-22°C during induction), and using specialized detergents like Hecameg for extraction and purification .

Another significant challenge involves correct incorporation of heme cofactors, which are essential for cytochrome b6 function. To enhance heme incorporation, supplementing growth media with δ-aminolevulinic acid (a heme precursor) and optimizing expression conditions to synchronize protein synthesis with cofactor availability can improve functional protein yields. Additionally, expression in host systems with robust heme biosynthesis pathways may prove advantageous .

For plastid-based expression specifically, ensuring proper processing of the petB intron presents another challenge. While the native carrot plastid machinery can process this intron, expression in heterologous systems may require using an intron-free construct or selecting hosts with compatible splicing mechanisms. When expressing in carrot plastids, the efficiency of transformation itself can be limiting, but this can be improved using endogenous flanking sequences derived from the carrot plastid genome for homologous recombination .

How can researchers distinguish between native and recombinant cytochrome b6 in transgenic Daucus carota?

Distinguishing between native and recombinant cytochrome b6 in transgenic Daucus carota requires strategic modifications to the recombinant construct and appropriate analytical techniques. The most effective approach involves incorporating a small epitope tag (such as FLAG, HA, or His6) at a non-critical position within the recombinant petB gene. The N-terminus is often suitable for tagging, as antibodies against this region are already available and have been used successfully in Western blot applications .

Western blot analysis using two different antibodies—one specific to the tag and another recognizing conserved regions of cytochrome b6—can effectively differentiate between native and recombinant proteins. Blue native PAGE (BN-PAGE) followed by second-dimension SDS-PAGE can separate intact complexes before protein denaturation, allowing assessment of whether the recombinant cytochrome b6 properly assembles into the cytochrome b6/f complex alongside native components .

Mass spectrometry offers another powerful approach for distinguishing the two forms. By introducing silent mutations that modify several codons without changing the amino acid sequence, researchers can create unique peptide signatures identifiable through proteomic analysis. For quantitative assessment, qRT-PCR can determine transgene copy number relative to native petB, while transcript analysis can verify expression levels of the recombinant gene .

What analytical methods can be used to assess the structural integrity of purified recombinant cytochrome b6?

Multiple complementary analytical techniques can provide comprehensive assessment of the structural integrity of purified recombinant cytochrome b6. Circular dichroism (CD) spectroscopy offers valuable insights into secondary structure composition, allowing comparison between recombinant and native proteins to confirm proper folding. For membrane proteins like cytochrome b6, CD measurements in the far-UV region (190-250 nm) are particularly informative about α-helical content, which should be high in properly folded cytochrome b6 .

UV-visible absorption spectroscopy provides essential information about cofactor incorporation and environment. Properly folded cytochrome b6 with correctly incorporated heme groups should exhibit characteristic absorption peaks at approximately 564 nm (α-bands). The ratio between the Soret band (typically around 415-425 nm) and protein absorption at 280 nm can serve as a quality metric for heme incorporation efficiency .

For more detailed structural analysis, limited proteolysis combined with mass spectrometry can probe the accessibility of different protein regions, with properly folded protein showing resistance to digestion at structured domains. Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can assess protein homogeneity and oligomeric state, while thermal shift assays provide information about protein stability. For the highest resolution structural insights, X-ray crystallography or cryo-electron microscopy may be employed, though these approaches are more challenging for membrane proteins .

How might CRISPR-Cas9 technology be applied to enhance petB expression in Daucus carota plastids?

While direct CRISPR-Cas9 editing of plastid genomes remains challenging due to difficulties in delivering the editing machinery to plastids, innovative approaches combining nuclear transformation and plastid targeting offer promising strategies for enhancing petB expression in Daucus carota. Researchers could express Cas9 with a plastid transit peptide from the nuclear genome, along with guide RNAs targeting regulatory regions upstream of the petB gene to modulate expression levels or introduce specific modifications to the gene itself .

One particularly promising approach involves creating synthetic promoters or enhancing existing regulatory elements controlling petB expression. By designing guide RNAs that target regions flanking the petB promoter, researchers could introduce modifications that increase promoter strength or optimize regulatory element arrangement. Additionally, CRISPR-Cas9 could be employed to modify intron splicing signals to enhance processing efficiency, potentially increasing mature transcript levels .

For more extensive modifications, researchers might develop two-step approaches where CRISPR-Cas9 is first used to create specific nuclear mutations affecting factors involved in plastid gene expression, followed by conventional plastid transformation to introduce the recombinant petB construct. This strategy could create a more favorable cellular environment for enhanced recombinant protein accumulation without directly editing the plastid genome. The availability of the complete plastid genome sequence for Daucus carota provides essential information for designing precise targeting strategies with minimal off-target effects .

What potential applications exist for engineered variants of cytochrome b6 in biotechnology and agriculture?

Engineered variants of cytochrome b6 offer diverse applications spanning biotechnology and agriculture. In photosynthesis engineering, modified cytochrome b6 variants could enhance electron transport efficiency, potentially increasing crop productivity under varying environmental conditions. By altering specific amino acids involved in electron transfer or quinol binding, researchers might create variants with optimized kinetic properties that reduce energy losses during photosynthesis .

Another promising application involves biosensors for environmental monitoring. The electron transfer properties of cytochrome b6 make it suitable for developing biological sensing systems for herbicides that target photosynthetic electron transport. Engineered variants with specific binding pockets could enhance sensitivity and selectivity for particular compounds, creating valuable tools for agricultural and environmental applications .

In biotechnology, cytochrome b6 variants could serve as components in artificial photosynthetic systems for sustainable energy production. By coupling engineered cytochrome b6/f complexes with photosensitizers and catalysts, researchers might develop systems that convert light energy into storable chemical energy, mimicking natural photosynthesis but optimized for specific applications. The potential for expressing these engineered proteins in carrot storage roots offers advantages for protein stability and long-term storage .

How can comparative genomics inform optimization strategies for petB expression across different plant species?

Comparative genomics provides valuable insights for optimizing petB expression strategies by identifying conserved regulatory elements, sequence motifs, and structural features across diverse plant species. Analysis of petB sequences and their genomic contexts across the plant kingdom reveals evolutionary constraints that indicate functionally critical regions versus those with greater tolerance for modification. This information can guide rational design of expression constructs that preserve essential features while optimizing others for specific host systems .

Examination of plastid genomes from various species shows that while the petB coding sequence is highly conserved, there are significant variations in regulatory regions, intron structures, and RNA processing signals. By comparing these elements between high-expressing and low-expressing species, researchers can identify sequence signatures associated with efficient gene expression. For instance, analysis of untranslated regions, ribosome binding sites, and RNA stability elements across species can guide the design of optimized expression cassettes .

The table below summarizes key parameters for petB from selected plant species that could inform optimization strategies:

Additionally, comparative analysis of plastid copy number and protein accumulation across species and tissue types provides insights into the relationship between gene dosage and protein expression. This information can help researchers develop tissue-specific expression strategies that maximize recombinant protein yields in target tissues, such as carrot storage roots. The success of BADH expression in carrot chromoplasts, where activity reached up to 74.8% of leaf tissue levels despite lower plastome copy numbers, demonstrates the potential for high-level expression in storage tissues when properly optimized .

What are the most promising avenues for advancing recombinant Daucus carota cytochrome b6 research?

The most promising directions for advancing recombinant Daucus carota cytochrome b6 research lie at the intersection of fundamental photosynthesis research and applied biotechnology. Optimizing plastid transformation protocols specifically for efficient petB expression represents a high-priority area, building upon the demonstrated success of expressing other proteins in carrot plastids. Developing carrot-specific expression vectors with endogenous regulatory elements derived from the sequenced plastid genome could significantly enhance transformation efficiency and expression levels .

Structure-function studies of cytochrome b6 variants offer another valuable research direction. By generating targeted modifications to specific domains and assessing their effects on electron transport efficiency, researchers can both advance fundamental understanding of photosynthesis and potentially develop variants with enhanced properties for biotechnological applications. The availability of accurate structural information from model organisms provides a foundation for rational design approaches .

Finally, exploring the potential of carrot storage roots as biofactories for recombinant cytochrome b6 and related proteins merits significant attention. The natural capacity of these organs for protein accumulation, combined with established transformation protocols and the availability of the complete plastid genome sequence, creates a promising platform for both research and potential commercial applications. Investigating the factors that enabled high-level BADH expression in carrot chromoplasts could inform strategies for optimizing cytochrome b6 expression in this system .

What standardized protocols and resources would benefit the research community working on recombinant photosynthetic proteins?

The development and dissemination of standardized protocols for key procedures would significantly accelerate research on recombinant photosynthetic proteins like cytochrome b6. Priority areas include optimized plastid transformation protocols specifically for Daucus carota, detailed procedures for purification of intact cytochrome b6/f complexes incorporating recombinant components, and validated functional assays that accurately measure electron transport activity in reconstituted systems. These standardized methods would facilitate reproducibility across laboratories and enable more direct comparison of results .

Shared genetic resources would also benefit the research community substantially. These could include a collection of characterized expression vectors containing various combinations of promoters, terminators, and targeting sequences optimized for plastid expression in Daucus carota. Similarly, a set of reference constructs encoding cytochrome b6 variants with known properties would provide valuable controls for new studies. The establishment of a carrot plastid mutant collection, potentially including lines with tagged or modified endogenous petB, would create a foundation for more sophisticated genetic studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.