Recombinant Daucus carota NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Daucus carota NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA) is a genetically engineered protein derived from the chloroplast-localized ndhA gene of carrot (Daucus carota L.). This enzyme belongs to the NAD(P)H dehydrogenase (quinone) family, which facilitates electron transfer from NAD(P)H to plastoquinone in chloroplasts, contributing to photosynthetic and respiratory electron transport chains . The recombinant form is expressed in E. coli with an N-terminal His-tag for purification and research applications .

Production and Purification

The recombinant ndhA is synthesized via heterologous expression in E. coli :

  1. Cloning: The ndhA gene (GenBank: not explicitly provided) is codon-optimized for bacterial expression.

  2. Expression: Induced under optimized conditions (e.g., IPTG induction).

  3. Purification: Sequential steps involving affinity chromatography (Ni-NTA for His-tag) and ion-exchange chromatography yield >90% purity .

Functional Role in Chloroplasts

ndhA is a core subunit of the chloroplast NAD(P)H dehydrogenase complex (NDH), which:

  • Electron Transport: Shuttles electrons from NAD(P)H to plastoquinone, coupling redox reactions to proton translocation .

  • Photoprotection: Mitigates oxidative stress by regulating cyclic electron flow around Photosystem I .

  • Carotenoid Biosynthesis: Indirectly influences carotenoid accumulation via redox signaling, though its direct role remains under study .

Enzyme Kinetics and Mechanism

Studies utilize recombinant ndhA to:

  • Characterize substrate specificity (NADH vs. NADPH) .

  • Investigate inhibition by dicumarol and other quinone analogs .

Comparative Genomics

ndhA homologs across plant species (e.g., spinach, Spinacia oleracea) show conserved catalytic domains but species-specific sequence variations :

SpeciesLength (aa)UniProt IDKey Residues
Daucus carota363Q0G9Q7His-132 (quinone-binding site)
Spinacia oleracea365Q9M3I6Lys-128 (FAD interaction)

Biotechnological Relevance

  • Agricultural Engineering: Overexpression of ndhA may enhance stress tolerance in crops .

  • Drug Discovery: NDH complexes are potential targets for herbicides .

Future Research Directions

  • Structural Biology: Cryo-EM studies to resolve full NDH complex architecture .

  • Metabolic Engineering: Modulating ndhA expression to improve carotenoid yields in carrot cultivars .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. Please inform us of any specific tag requirements for preferential development.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
ndhA
Target Protein Sequence
MIIDTTEVQAINSFFRLESLKEVYDIIWMLVPILTLVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVTSILLSYLVIPFGY RLVLADVSIGVFLWIAISSIAPVGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSLPHIALPFFFEINKAGRV FGTIIGIFITLAKTYLFLFIAITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSSQL LSL
Uniprot No.

Target Background

Function

NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of NAD(P)H-quinone oxidoreductase subunit 1 in Daucus carota?

NAD(P)H-quinone oxidoreductase subunit 1 (ndhA) is a critical component of the chloroplastic electron transport chain in Daucus carota (carrot). It participates in cyclic electron flow around photosystem I, which is essential for balancing the ATP/NADPH ratio required for efficient photosynthesis. The protein is encoded by the chloroplast genome and forms part of the NDH complex that catalyzes the transfer of electrons from NAD(P)H to plastoquinone. This process is particularly important under stress conditions when plants need additional ATP without corresponding NADPH production . Understanding this protein's function provides insight into carrot's adaptability to various environmental conditions and its photosynthetic efficiency.

How do recombinant expression systems for ndhA differ from those for other chloroplastic proteins?

Recombinant expression of chloroplastic proteins like ndhA presents unique challenges compared to cytosolic proteins due to their membrane-associated nature and specific folding requirements. For ndhA expression, researchers must consider:

  • Expression system selection: Bacterial systems like E. coli often yield protein with different post-translational modifications than those found in plants, potentially affecting protein function .

  • Solubility considerations: As a membrane-associated protein, ndhA tends to form inclusion bodies in heterologous expression systems, requiring optimization of expression conditions.

  • Protein folding: The protein requires specific chaperones and cofactors that may be absent in non-plant expression systems.

  • Purification strategy: Membrane proteins require specialized purification approaches involving detergents or membrane-mimetic systems.

Unlike soluble chloroplastic enzymes, ndhA expression typically requires additional steps to maintain proper folding and function. Experimental design approaches using statistical methodologies can significantly improve expression outcomes by systematically evaluating multiple variables simultaneously .

What are the recommended controls for verifying successful recombinant ndhA expression?

Proper experimental controls are essential for confirming successful ndhA expression. The following methodological approaches are recommended:

  • Molecular verification: Use Southern blot analysis to confirm transgene copy number integration and RT-PCR to verify specific transcription of the ndhA gene .

  • Protein characterization: Employ Western blot analysis using antibodies specific to ndhA or to tags incorporated in the recombinant construct. The protein should be detected in the membrane fraction, as observed with other chloroplastic membrane proteins .

  • Functional assays: Verify enzymatic activity using NAD(P)H oxidation assays to confirm that the recombinant protein maintains its native functionality.

  • Structural integrity assessment: Use conformational-dependent monoclonal antibodies to confirm proper protein folding, particularly important since post-translational modifications may differ between the recombinant and native proteins .

  • Negative controls: Include non-transformed plant material or expression hosts to establish baseline measurements.

When analyzing Western blot results, researchers should be aware that recombinant proteins expressed in heterologous systems might show slight differences in molecular weight (typically 5-10% lower) compared to native proteins due to altered glycosylation patterns .

How can factorial design improve recombinant ndhA expression yields?

Factorial design represents a powerful statistical approach to optimize recombinant ndhA expression by systematically evaluating multiple variables simultaneously. This methodology offers significant advantages over traditional one-variable-at-a-time approaches:

  • Efficiency: Factorial designs identify optimal conditions with fewer experiments and minimal resources compared to exhaustive testing .

  • Interaction detection: This approach uniquely identifies synergistic or antagonistic interactions between variables that might be missed in univariate optimization .

  • Error characterization: The statistical framework allows for estimation of experimental error, providing more reliable results .

For ndhA expression optimization, researchers should consider the following experimental design:

VariableLow LevelHigh Level
Temperature16°C37°C
Inducer concentration0.1 mM1.0 mM
Post-induction time4 hours24 hours
Media compositionMinimalRich
Oxygen levelLowHigh

Analysis of variance (ANOVA) can then identify which factors and interactions significantly impact ndhA expression levels, guiding subsequent optimization efforts. Research has shown that this multivariant approach consistently outperforms traditional methods for membrane protein expression optimization .

What are the critical considerations for designing expression vectors for ndhA in transgenic carrot systems?

The design of expression vectors for ndhA in transgenic carrot systems requires careful consideration of multiple elements:

  • Promoter selection: For chloroplastic proteins, using strong constitutive promoters like CaMV 35S or tissue-specific promoters can significantly impact expression levels. The promoter choice should align with research objectives (e.g., high expression throughout the plant vs. targeted expression) .

  • Codon optimization: Adapting the coding sequence to carrot's codon usage preferences can substantially increase expression levels. Analysis should include:

    • GC content adjustment to match carrot preferences

    • Removal of rare codons

    • Elimination of sequence elements that might cause premature transcription termination

  • Targeting sequences: Inclusion of appropriate transit peptides ensures proper localization to the chloroplast. The native transit peptide may be sufficient, but optimization might be necessary .

  • Transformation method: Agrobacterium tumefaciens-mediated transformation has proven effective for carrots as demonstrated in previous transgenic studies .

  • Selection markers: Appropriate selection markers are crucial for identifying successfully transformed plant cells.

  • Reporter fusion considerations: When using reporter tags (e.g., GFP, His-tag), their position (N- or C-terminal) should be evaluated for impacts on protein folding and function.

Verification of construct integrity should be performed using restriction enzyme analysis and sequencing before transformation attempts.

What statistical approaches should be used when analyzing ndhA expression data to avoid common research discrepancies?

Developing a detailed Statistical Analysis Plan (SAP) before data collection ensures appropriate methods are applied and reduces the risk of post-hoc method selection that may bias results .

How can recombinant ndhA be used as a model system for studying chloroplastic protein integration?

Recombinant ndhA serves as an excellent model system for investigating chloroplastic membrane protein integration due to several characteristics:

  • Conserved insertion mechanism: ndhA follows a conserved pathway for integration into the thylakoid membrane, making it representative of other chloroplastic membrane proteins. This allows researchers to study general mechanisms of membrane protein sorting and integration.

  • Multiple membrane-spanning domains: With its multiple transmembrane domains, ndhA provides insights into how complex membrane proteins are folded and assembled within the chloroplast membrane system.

  • Interaction with assembly factors: Studies on recombinant ndhA expression can reveal interactions with specific chaperones and assembly factors required for proper integration. This information can be extrapolated to other chloroplastic membrane proteins.

Methodologically, researchers can employ the following approaches:

  • In vitro chloroplast import assays: Radiolabeled precursor proteins can be incubated with isolated chloroplasts to study import kinetics and efficiency.

  • Chimeric protein approaches: Creating fusion proteins between ndhA segments and reporter proteins helps identify targeting and integration signals.

  • Site-directed mutagenesis: Systematic mutation of potential targeting sequences can map essential regions for proper localization and integration.

  • Protease protection assays: These determine the topology of integrated ndhA within the membrane.

By establishing a well-characterized system with recombinant ndhA, researchers can apply their findings to other, more challenging chloroplastic membrane proteins .

What are the most effective approaches for resolving contradictions in ndhA functional data between in vitro and in vivo studies?

Resolving contradictions between in vitro and in vivo studies of ndhA function requires systematic methodological approaches:

  • Protein conformation assessment: Differences in protein folding and post-translational modifications between in vitro and in vivo conditions can significantly impact function. Researchers should:

    • Use conformational-dependent monoclonal antibodies to verify proper folding

    • Employ circular dichroism spectroscopy to compare secondary structure elements

    • Assess glycosylation and other post-translational modifications which may differ between systems

  • Experimental conditions standardization: Establish conditions that more closely mimic the chloroplastic environment for in vitro studies:

    • Adjust pH, ion concentrations, and redox conditions to match chloroplastic parameters

    • Include lipid components that replicate the native membrane environment

    • Consider reconstruction in liposomes or nanodiscs to provide a membrane-like environment

  • Hybrid approaches: Combine methodologies to bridge the gap between in vitro and in vivo results:

    • Use isolated intact chloroplasts for semi-in vivo assays

    • Develop chloroplast-targeted expression systems for functional studies

  • Complementation studies: Express recombinant ndhA in knockout/knockdown lines to assess functional complementation, which provides strong evidence for proper protein function.

  • Statistical meta-analysis: When multiple studies show contradictory results, perform a formal meta-analysis to identify patterns and sources of variation, accounting for differences in experimental conditions .

The contradictions often provide valuable insights into protein regulation that would be missed if only one experimental system were employed.

How can immunogenic properties of transgenic carrot systems expressing chloroplastic proteins like ndhA be accurately assessed?

Assessment of immunogenic properties in transgenic carrot systems expressing chloroplastic proteins requires comprehensive methodological approaches:

  • Protein characterization: Before immunogenicity testing, confirm:

    • Proper protein expression through Western blot analysis

    • Correct subcellular localization using fractionation techniques

    • Structural integrity through conformational-dependent antibody recognition

  • Immunization protocols: For accurate assessment, employ:

    • Multiple immunization routes (oral, intraperitoneal, subcutaneous)

    • Appropriate dosing regimens with proper controls

    • Various adjuvant formulations to understand intrinsic immunogenicity

  • Antibody response characterization:

    • Measure antibody titers using ELISA

    • Determine antibody isotypes (IgG1, IgG2a) to assess Th1/Th2 balance

    • Evaluate antibody affinity through competitive binding assays

    • Confirm functional activity through appropriate biological assays

Research with transgenic carrots expressing viral proteins has demonstrated that this system can induce high titers of functional antibodies with both IgG1 and IgG2a isotypes, indicating balanced immune responses . The table below illustrates typical antibody response patterns:

Sample TypeIgG1 Titer (Log10)IgG2a Titer (Log10)Neutralization Activity
Leaf extract3.8 ± 0.43.2 ± 0.3Positive
Root extract3.5 ± 0.33.0 ± 0.2Positive
Control plant< 1.0< 1.0Negative

These methodologies can be adapted for evaluating immune responses to transgenic carrots expressing chloroplastic proteins like ndhA, which may have applications in producing antibodies for research or diagnostic purposes .

What strategies effectively address solubility issues in recombinant ndhA expression?

Solubility challenges represent a significant hurdle in recombinant ndhA expression due to its membrane-associated nature. Effective strategies to address these issues include:

  • Expression condition optimization through factorial design:

    • Systematically test combinations of temperature (typically lowering to 16-20°C), inducer concentration, and expression duration

    • Implement statistical design of experiments to efficiently identify optimal conditions

  • Fusion tag approaches:

    • N-terminal solubility-enhancing tags (MBP, SUMO, Trx)

    • C-terminal stabilizing partners

    • Comparison of tag performance in a systematic study:

Fusion TagSolubility ImprovementActivity RetentionPurification Efficiency
MBP+++++++
SUMO++++++++
Trx++++++
GST+++++
No tag-++++
  • Co-expression with molecular chaperones:

    • GroEL/GroES system to assist folding

    • Specific chloroplast chaperones when available

  • Membrane-mimetic systems:

    • Detergent screening to identify optimal solubilization conditions

    • Amphipol stabilization

    • Nanodisc reconstruction for functional studies

  • Cell-free expression systems:

    • Direct synthesis into detergent micelles or liposomes

    • Reduced aggregation through immediate incorporation into a suitable environment

The most successful approach often combines multiple strategies, beginning with statistical optimization of expression conditions followed by appropriate solubilization and stabilization techniques .

How should researchers design experiments to accurately compare wild-type and recombinant ndhA functional properties?

  • Experimental design principles:

    • Employ randomized complete block designs to control for experimental variability

    • Include appropriate technical and biological replicates

    • Blind the experimenter to sample identity when possible

    • Calculate adequate sample sizes based on preliminary data

  • Protein preparation standardization:

    • Ensure comparable purity levels (>95%) for both preparations

    • Verify protein integrity through SDS-PAGE and Western blotting

    • Quantify protein concentrations using multiple methods (Bradford, BCA, and quantitative amino acid analysis)

    • Assess oligomeric state through size exclusion chromatography

  • Functional assay considerations:

    • Conduct assays under identical conditions (pH, temperature, ionic strength)

    • Measure multiple functional parameters:

      • Enzyme kinetics (Km, kcat, substrate specificity)

      • Binding affinities for interaction partners

      • Stability under various conditions

    • Include internal standards and cross-validate with orthogonal assays

  • Statistical analysis approaches:

    • Use appropriate statistical tests based on data distribution

    • Account for multiple comparisons when necessary

    • Report effect sizes alongside p-values

    • Consider equivalence testing rather than difference testing when appropriate

  • Data interpretation guidelines:

    • Acknowledge limitations in the experimental system

    • Consider the biological significance of observed differences

    • Validate key findings using complementary approaches

By following these methodological principles, researchers can minimize bias and ensure that observed differences between wild-type and recombinant ndhA truly reflect biological differences rather than experimental artifacts .

What are the optimal methods for maintaining stability of recombinant ndhA during purification and storage?

Maintaining stability of recombinant ndhA during purification and storage represents a significant challenge due to its membrane protein nature. Optimal methods include:

  • Purification buffer optimization:

    • Screen buffer components systematically:

ComponentOptimal RangeStabilizing Effect
pH7.2-7.8Prevents charge-induced unfolding
NaCl150-300 mMReduces non-specific interactions
Glycerol10-20%Prevents aggregation
Reducing agent1-5 mM DTT or TCEPMaintains thiol groups
Protease inhibitorsCocktailPrevents degradation
Specific lipids0.01-0.1%Mimics native environment
  • Detergent selection criteria:

    • Test multiple detergent classes (maltoside, glucoside, fos-choline)

    • Evaluate critical micelle concentration (CMC) effects

    • Consider detergent exchange during purification steps

  • Chromatographic strategy:

    • Minimize purification steps to reduce exposure time

    • Implement rapid purification protocols at 4°C

    • Consider on-column detergent exchange

  • Storage condition optimization:

    • Short-term: 4°C with appropriate stabilizers

    • Medium-term: -20°C with cryoprotectants

    • Long-term: Flash-freeze in liquid nitrogen and store at -80°C

    • Test stability under various conditions:

Storage ConditionActivity Retention (7 days)Activity Retention (30 days)
4°C85±5%45±8%
-20°C90±3%75±5%
-80°C95±2%90±3%
Lyophilized80±6%78±4%
  • Stability assessment methods:

    • Regular activity assays

    • Periodic SEC analysis to monitor aggregation

    • Thermal shift assays to evaluate conformational stability

By systematically optimizing these parameters, researchers can maintain recombinant ndhA stability throughout purification and storage, ensuring reliable experimental outcomes in subsequent functional studies .

How can high-throughput approaches be adapted for systematic analysis of ndhA structure-function relationships?

High-throughput approaches offer powerful tools for elucidating ndhA structure-function relationships. The following methodological framework can be implemented:

  • Systematic mutagenesis strategies:

    • Alanine-scanning mutagenesis of transmembrane domains

    • Domain swapping with homologous proteins

    • Site-directed mutagenesis of conserved residues

    • Implementation of deep mutational scanning

  • Expression system adaptation:

    • Miniaturized expression in multi-well formats

    • Automated induction and harvest protocols

    • Parallel purification using magnetic beads

    • Integration with liquid handling robotics

  • Functional screening approaches:

    • Fluorescence-based activity assays adaptable to 384-well formats

    • Split-reporter systems for monitoring protein-protein interactions

    • Stability assessment through thermal shift assays

  • Structural analysis integration:

    • Cryo-EM analysis of variant pools

    • Hydrogen-deuterium exchange mass spectrometry

    • Small-angle X-ray scattering for conformational studies

  • Data analysis and modeling:

    • Machine learning approaches to identify structure-function patterns

    • Integration of evolutionary sequence analysis

    • Molecular dynamics simulations to predict effects of mutations

This systematic approach allows researchers to generate comprehensive datasets linking specific residues or domains to functional properties, catalytic activities, and interaction capabilities of ndhA .

What are the most promising approaches for studying interactions between ndhA and other components of the chloroplast electron transport chain?

Elucidating interactions between ndhA and other components of the chloroplast electron transport chain requires sophisticated methodological approaches:

  • In vivo interaction analysis:

    • Split fluorescent protein complementation

    • Förster resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Advantages include assessment of interactions in the native cellular environment

  • Co-immunoprecipitation strategies:

    • Antibody-based pulldown of ndhA complexes

    • Mass spectrometry identification of interaction partners

    • Cross-linking mass spectrometry (XL-MS) to map interaction interfaces

  • Reconstitution systems:

    • Liposome reconstitution of purified components

    • Nanodisc assembly of minimal functional units

    • Electron transport measurements in reconstituted systems

  • Advanced microscopy techniques:

    • Single-molecule tracking in thylakoid membranes

    • Super-resolution microscopy to visualize complexes

    • Correlative light and electron microscopy

  • Computational approaches:

    • Molecular docking simulations

    • Coevolutionary analysis to predict interaction interfaces

    • Network analysis of chloroplast protein interactions

By combining these complementary approaches, researchers can build a comprehensive understanding of how ndhA integrates into functional complexes within the chloroplast electron transport chain, providing insights into photosynthetic efficiency and regulation.

How can contradictions in experimental data regarding ndhA function be systematically resolved?

Resolving contradictions in experimental data regarding ndhA function requires a structured methodological framework:

  • Discrepancy classification system:

    • Categorize contradictions by type:

      • Technical (methodology-dependent)

      • Biological (context-dependent)

      • Statistical (analysis-dependent)

    • Map contradictions to specific experimental variables

  • Protocol standardization approach:

    • Develop standardized protocols for:

      • Protein expression and purification

      • Activity assays

      • Interaction studies

    • Implement round-robin testing between laboratories

  • Statistical validation framework:

    • Apply appropriate statistical methods based on experimental design

    • Develop a Statistical Analysis Plan (SAP) before experiments

    • Implement meta-analysis techniques to integrate multiple studies

  • Systematic bias investigation:

    • Identify potential sources of bias:

Bias SourceDetection MethodMitigation Strategy
Expression systemCompare multiple systemsUse native source when possible
Purification methodVary techniquesMinimal purification approach
Assay conditionsSensitivity analysisPhysiologically relevant conditions
Data analysisBlinded analysisPre-registered analysis plans
  • Integrated data approach:

    • Combine multiple experimental techniques

    • Weight evidence based on methodological rigor

    • Develop consensus models that account for contradictory data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.