Recombinant Daucus carota NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Daucus carota NAD(P)H-Quinone Oxidoreductase Subunit 3 (ndhC)

Recombinant Daucus carota NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a heterologously expressed protein derived from the chloroplast-encoded gene ndhC in carrot (Daucus carota). This subunit is part of the chloroplast NADH dehydrogenase (NDH) complex, which plays a critical role in cyclic electron flow (CEF) and photosynthetic efficiency . The recombinant form is typically expressed in E. coli with an N-terminal His-tag for purification and structural studies .

Protein Structure and Expression

The recombinant ndhC protein corresponds to the full-length chloroplast-encoded subunit (1–120 amino acids) fused to a His-tag . Key structural features include:

  • Transmembrane domains: Integral membrane protein with predicted alpha-helical structures .

  • Functional domains: Binds FMN and iron-sulfur (Fe-S) clusters, facilitating electron transfer from NAD(P)H to plastoquinone .

Enzymatic Activity and Role in Photosynthesis

The ndhC subunit is essential for the NDH complex’s function in:

  1. Cyclic electron flow: Shuttles electrons from NAD(P)H to plastoquinone, generating a proton gradient for ATP synthesis .

  2. Proton translocation: Coupled redox reactions to proton pumping, enhancing photosynthetic efficiency under stress .

Plastid Genome Organization

The ndhC gene is located in the large single-copy (LSC) region of the Daucus carota plastid genome (155,911 bp) . The genome contains 115 unique genes, including 81 protein-coding genes, with ndhC being one of 10 duplicated genes in the inverted repeat (IR) .

Table 2: Daucus carota Plastid Genome Features Relevant to ndhC

FeatureDescriptionSource
Genome size155,911 bp
Gene locationLarge single-copy (LSC) region
IR duplication21 duplicated genes, including ndhC
Subunit classificationPart of subcomplex A (stroma-exposed) in NDH

Evolutionary Significance

Phylogenetic analyses place Daucus carota as sister to Panax in the euasterid II clade, sharing conserved plastid genome structures . The ndhC sequence aligns with other Apiaceae species, reflecting evolutionary conservation in NDH complex assembly .

Challenges in Heterologous Expression

Key limitations include:

  • Post-translational modifications: Native chloroplast-targeted modifications (e.g., phosphorylation) are absent in E. coli .

  • Subcomplex instability: Recombinant ndhC requires co-expression with other NDH subunits (e.g., ndhH–ndhK) for functional assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSLIPILAFFVSGVLAPINKGPEKLSSYESGIEPMGNAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGISVFVEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, the primary electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Daucus carota NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) and where is it located in the cell?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a chloroplastic protein encoded in the plastid genome of Daucus carota (carrot). As indicated by its name, this protein is specifically located in the chloroplast . The ndhC gene is part of the complete Daucus carota plastid genome, which spans 155,911 base pairs in length . This protein functions as a subunit of the larger NAD(P)H-quinone oxidoreductase complex, which participates in electron transport processes within the chloroplast.

What is the primary function of NAD(P)H-quinone oxidoreductase in plants?

NAD(P)H-quinone oxidoreductases in plants, including ndhC, catalyze the two-electron reduction of quinones and a variety of other organic compounds . Similar to their counterparts in other organisms, plant NAD(P)H-quinone oxidoreductases likely play crucial roles in:

  • Reducing the free radical load in cells

  • Participating in chloroplastic electron transport chains

  • Contributing to cellular redox homeostasis

  • Protecting against oxidative stress

Unlike single-electron transfer mechanisms, the two-electron reduction catalyzed by these enzymes avoids the production of reactive semiquinones, thereby preventing oxidative damage to cellular components .

How is recombinant Daucus carota ndhC typically produced and stored?

Recombinant Daucus carota ndhC can be produced in several expression systems, including:

  • Escherichia coli

  • Yeast

  • Baculovirus

  • Mammalian cell expression systems

The recombinant protein is typically:

  • Purified to >90% purity

  • Supplied in liquid form containing glycerol

  • Stored at -20°C for regular use

  • Stored at -80°C for long-term preservation

  • Functional when working aliquots are stored at 4°C for up to one week

It's important to note that repeated freezing and thawing cycles should be avoided to maintain protein integrity and activity .

What are the key structural features of ndhC and how do they compare to other NAD(P)H-quinone oxidoreductases?

While specific structural information on Daucus carota ndhC is limited in the provided sources, we can draw parallels with better-characterized NAD(P)H-quinone oxidoreductases. NAD(P)H-quinone oxidoreductases typically function as homodimers with two active sites located at the interface between subunits .

Key structural features likely include:

  • An FAD binding domain that tightly associates with the FAD cofactor

  • NAD(P)H binding sites where the nicotinamide ring positions parallel to FAD for efficient electron transfer

  • Quinone substrate binding regions

Similar to human NQO1, plant ndhC likely forms part of a complex where "both active sites comprise residues from both subunits" . This structural arrangement facilitates the enzyme's function in electron transport within the chloroplast.

What cofactors are essential for ndhC function and how do they interact with the protein?

Based on research with similar enzymes, ndhC likely requires FAD as an essential cofactor . In NAD(P)H-quinone oxidoreductases, FAD plays a crucial role in the catalytic mechanism by:

  • Accepting electrons from NAD(P)H in the first stage of the reaction

  • Transferring these electrons to quinone substrates in the second stage

  • Facilitating the two-electron reduction that avoids semiquinone formation

The catalytic mechanism typically follows a substituted enzyme (ping-pong) mechanism where the FAD cofactor is first reduced by NAD(P)H, and then the reduced FAD transfers electrons to the quinone substrate .

What expression systems yield optimal results for producing functional recombinant ndhC?

Multiple expression systems can be employed for producing recombinant Daucus carota ndhC, including E. coli, yeast, baculovirus, and mammalian cell systems . The optimal choice depends on research objectives and required protein characteristics.

Comparative Expression System Analysis:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, rapid growth, economicalPossible improper folding, lack of post-translational modificationsBasic structural studies, antibody production
YeastSome post-translational modifications, relatively high yieldMore complex than bacterial systemsFunctional studies requiring limited modifications
BaculovirusEnhanced protein folding, post-translational modificationsLower yield, more time-consumingStudies requiring authentic enzyme activity
Mammalian cellMost authentic post-translational modifications and foldingLowest yield, highest cost, technical complexityStudies focusing on protein-protein interactions

The optimal expression system should be determined based on experimental goals, required protein purity, and the importance of post-translational modifications for activity.

What purification strategies yield the highest purity and activity for recombinant ndhC?

While specific purification protocols for Daucus carota ndhC are not detailed in the provided sources, effective purification strategies can be inferred from approaches used with similar proteins:

  • Initial Capture:

    • Affinity chromatography using His-tags or other fusion tags

    • Ion exchange chromatography exploiting the protein's charge properties

  • Intermediate Purification:

    • Hydrophobic interaction chromatography

    • Size exclusion chromatography to separate oligomeric forms

  • Polishing Steps:

    • High-resolution ion exchange chromatography

    • Removal of fusion tags if necessary

Throughout purification, it's critical to monitor:

  • Protein purity (typically >90% is achievable)

  • Enzymatic activity using substrate conversion assays

  • Proper folding through circular dichroism or fluorescence spectroscopy

Final purified protein should be stored in a stabilizing buffer containing glycerol to maintain activity during storage .

How can site-directed mutagenesis of ndhC provide insights into its function and electron transport mechanisms?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in ndhC. Based on studies of related proteins, several strategies can be implemented:

  • Targeting FAD-binding residues:
    Mutations in residues involved in FAD binding would likely affect cofactor affinity and orientation, directly impacting electron transfer efficiency.

  • Altering NAD(P)H binding sites:
    Mutations in the NAD(P)H binding pocket could reveal specificity determinants between NADH and NADPH utilization, as NAD(P)H-quinone oxidoreductases can often use both cofactors with similar efficiency .

  • Modifying quinone binding sites:
    Mutations affecting quinone substrate interactions would help map the active site and identify residues critical for substrate specificity.

  • Investigating subunit interface residues:
    As these enzymes typically function as dimers with active sites formed between subunits , mutations at the interface could provide insights into quaternary structure importance.

Results from such mutagenesis studies can be analyzed using:

  • Steady-state enzyme kinetics to determine effects on Km and kcat

  • Binding studies to assess cofactor and substrate affinities

  • Structural analyses to observe conformational changes

What role does ndhC play in cyclic electron flow and how does this impact photosynthetic efficiency?

As a component of the chloroplastic NAD(P)H dehydrogenase complex, ndhC likely participates in cyclic electron flow around photosystem I. This process has several important physiological implications:

  • ATP/NADPH ratio adjustment:
    Cyclic electron flow generates ATP without producing NADPH, allowing plants to balance the ATP:NADPH ratio according to metabolic demands.

  • Photoprotection:
    By providing an alternative electron flow pathway, the NAD(P)H dehydrogenase complex helps dissipate excess excitation energy, protecting photosynthetic apparatus from photodamage.

  • Adaptation to environmental stresses:
    The complex's activity may be modulated under various stress conditions, including high light, drought, and temperature extremes.

Research methodologies to investigate these functions include:

  • Comparative analyses of wild-type plants versus ndhC mutants

  • Chlorophyll fluorescence measurements to assess photosynthetic electron transport

  • Measurements of ATP/NADPH ratios under various light conditions

  • Analysis of stress response in plants with altered ndhC expression

How is the ndhC gene organized in the carrot plastid genome and what does this reveal about its evolution?

The ndhC gene is encoded in the carrot plastid genome, which is 155,911 base pairs in length . The carrot plastid genome, like other angiosperms, contains inverted repeats that are 27,051 bp long and separated by small and large single-copy regions .

Within this genomic context, several observations can be made about ndhC:

  • As part of the plastid genome, ndhC is maternally inherited in most angiosperms

  • The gene likely evolved from cyanobacterial ancestors, reflecting the endosymbiotic origin of chloroplasts

  • The complete carrot plastid genome contains 115 unique genes and 21 duplicated genes within the inverted repeat regions

Comparative genomic analyses across plant species reveal that ndh genes, including ndhC, are conserved in most photosynthetic plants but have been lost in some parasitic and aquatic plants, suggesting their role is non-essential under certain ecological conditions.

How does carrot ndhC compare to homologous proteins in other plant species?

Comparative analysis of ndhC across different plant species provides insights into evolutionary conservation and species-specific adaptations. While detailed comparative data specifically for carrot ndhC is not provided in the search results, general patterns observed in plastid-encoded proteins suggest:

  • Core functional domains are typically highly conserved across diverse plant lineages, reflecting their fundamental role in photosynthesis

  • Species-specific variations may occur in regions less critical for catalytic function

  • Selective pressure on ndh genes varies across plant lineages, with some parasitic and aquatic plants having lost functional ndh genes

The complete sequencing of the carrot plastid genome has enabled such comparative analyses, contributing to our understanding of angiosperm phylogeny . Specifically, phylogenetic analyses using plastid gene sequences have provided strong support for major angiosperm clades, including monocots, eudicots, rosids, asterids, eurosids II, euasterids I, and euasterids II, with carrot belonging to the euasterid II clade .

What experimental approaches can be used to study ndhC interactions with other components of the photosynthetic apparatus?

Investigating how ndhC interacts with other components of the photosynthetic machinery requires sophisticated experimental approaches:

These experimental strategies can reveal how ndhC functions within the larger context of the photosynthetic apparatus and how its interactions change under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.