Recombinant Daucus carota NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant ndhE is typically expressed in Escherichia coli systems for high yield and purity .

ParameterDetails
Expression HostE. coli (cell-free systems for optimal folding)
TagN-terminal His-tag for affinity chromatography
Purity≥85% (verified by SDS-PAGE)
Storage-20°C in glycerol-containing buffer

Biochemical and Pharmacological Roles

Comparative Analysis with Homologs

The ndhE subunit shares functional parallels with bacterial and mammalian NQOs but exhibits distinct structural adaptations for chloroplast-specific activity:

FeatureD. carota ndhEHuman NQO1
LocalizationChloroplast membrane Cytosol
Primary RoleCyclic electron transport Xenobiotic detoxification
Cofactor DependenceFAD, NAD(P)H FAD, NAD(P)H
InhibitorsNot characterizedDicoumarol, ES936

Research Applications

  • Biochemical Studies: Used to elucidate the NDH complex’s role in photoprotection and stress responses in plants .

  • Biotechnology: Transgenic carrot systems (e.g., measles virus antigen production ) highlight the potential for ndhE in plant-based recombinant protein platforms.

  • Drug Discovery: Structural insights from homologous NQOs (e.g., human QR1 ) guide the design of enzyme-targeted therapeutics.

Unresolved Questions and Future Directions

  • Substrate Specificity: The exact quinone substrates of ndhE in D. carota remain uncharacterized.

  • In Vivo Role: Knockout studies are needed to clarify its contribution to chloroplast redox balance versus respiratory pathways.

  • Industrial Scaling: Optimizing expression in plant hosts (e.g., Nicotiana ) could enhance yield for commercial applications.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that specific tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLSAYLFSVGLYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGS IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. NDH couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) in Daucus carota?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is encoded within the chloroplast genome of Daucus carota. With the recent telomere-to-telomere (T2T) genome assembly, we now have a more comprehensive understanding of the carrot genome structure. The complete D. carota genome spans approximately 430.40 Mb across 9 chromosomes, with a contig N50 of 45.71 Mb, representing a significant improvement over the previous assembly (D. carota v2.0) which had 4,826 scaffolds and lacked telomeric and centromeric regions . While the ndhE gene specifically isn't directly mentioned in the search results, it would be part of the chloroplastic genome, which is typically circular and separate from the nuclear genome. The improved genome assembly provides a better framework for understanding the genomic environment and potential regulatory elements that may influence ndhE expression and function.

How does the ndhE subunit contribute to photosynthetic processes in carrot plants?

The ndhE subunit forms an essential component of the NAD(P)H dehydrogenase (NDH) complex in the chloroplast electron transport chain. This complex facilitates cyclic electron flow around photosystem I, playing a crucial role in balancing the ATP:NADPH ratio during photosynthesis. The NDH complex contributes to photoprotection under high light or drought stress conditions by preventing over-reduction of the electron transport chain.

In carrots specifically, the function of ndhE must be considered in the context of the plant's unique metabolism, particularly its high carotenoid content in the root tissue. Research has shown that during carrot development, significant changes occur in carotenoid accumulation, with total carotenoid content increasing more than eightfold between early development and 90 days after sowing (reaching 2.71 mg/g dry weight) . While not directly linked in the literature, the photosynthetic processes supported by ndhE function ultimately provide the energy needed for these biosynthetic pathways.

What conserved domains and motifs characterize the ndhE protein structure?

While specific information about ndhE domains from the search results is limited, we can draw from related research on NAD(P)H-quinone oxidoreductase subunits. The ndhE protein contains transmembrane domains that anchor it within the thylakoid membrane. Conservation analysis across plant species typically reveals several highly conserved residues crucial for protein-protein interactions within the NDH complex and for electron transfer functionality.

Researchers investigating ndhE structure should consider employing analytical approaches similar to those used for related proteins. For example, when expressing recombinant proteins like PSY2 and LCYB1 from Daucus carota, researchers have optimized codons based on Malus domestica (apple) codon usage using software like OPTIMIZER, and verified reading frames and amino acid homology with Vector NTI software . Similar approaches would be valuable for ndhE structural studies.

How does ndhE expression vary across different developmental stages and tissues in Daucus carota?

Expression patterns of chloroplast genes like ndhE can vary significantly across developmental stages and tissues. Although the search results don't provide direct information about ndhE expression specifically, we can draw insights from methodologies used to study other carrot genes. RNA extraction protocols using cetyltrimethylammonium bromide (CTAB) have been successfully employed for isolating RNA from different carrot tissues, such as tepals and floral buds . This approach, combined with DNase I and RNase A treatments to ensure sample purity, would be appropriate for studying ndhE expression.

To investigate developmental variation, researchers should collect samples across multiple growth stages, as demonstrated in studies of carotenoid accumulation in carrots where significant changes were observed throughout root development . Quantitative RT-PCR can be employed to measure expression levels, using appropriate reference genes for normalization. When designing such experiments, researchers should include multiple biological and technical replicates to account for natural variation.

What is known about the interactions between ndhE and other subunits of the NDH complex?

The NDH complex in chloroplasts consists of multiple subunits that interact to form a functional electron transport apparatus. While the search results don't specifically address ndhE interactions, understanding protein-protein interactions within multisubunit complexes like NDH requires sophisticated analytical approaches.

What is the evolutionary conservation of ndhE across different plant species compared to Daucus carota?

Evolutionary analysis of ndhE would involve comparative genomics approaches across multiple plant species. The high conservation observed in the carrot genome through BUSCO assessment (98.9% of conserved genes were matched, with 1529 single-copy homologous genes and 68 multi-copy homologous genes) suggests that essential chloroplast proteins like ndhE are likely well-conserved.

  • Extract ndhE sequences from multiple plant species, particularly within Apiaceae and other related families

  • Perform multiple sequence alignments using tools like MUSCLE or MAFFT

  • Generate phylogenetic trees using maximum likelihood or Bayesian methods

  • Calculate selection pressures using dN/dS ratios to identify conserved regions under purifying selection

This approach would reveal the degree of ndhE conservation and potentially identify species-specific adaptations that might relate to specific ecological niches or photosynthetic strategies.

What are the optimal protocols for isolating and purifying recombinant ndhE protein from Daucus carota?

For isolating recombinant ndhE protein from Daucus carota, researchers should consider a multi-step approach:

  • Gene Cloning and Vector Construction: The ndhE gene should be amplified from carrot chloroplast DNA using high-fidelity polymerase. For optimal expression, codon optimization based on the host expression system is recommended, similar to the approach used for other carrot genes like PSY2 and LCYB1 . The OPTIMIZER software can be employed for codon optimization, and Vector NTI software can verify correct reading frames.

  • Expression System Selection: For chloroplast proteins like ndhE, adding a plastidial signal peptide (such as the 171 bp signal peptide from the small subunit of pea RUBISCO) can enhance proper targeting and folding . Expression in a plant-based system may provide more authentic post-translational modifications compared to bacterial systems.

  • Protein Purification: A multi-step purification process typically yields the best results, beginning with crude extraction followed by affinity chromatography (using an appropriate tag), ion exchange chromatography, and size exclusion chromatography.

  • Quality Control: Assess protein purity using SDS-PAGE and verify functional integrity through activity assays specific to NAD(P)H oxidoreductase function.

For characterizing the purified protein, researchers should consider functional assays that measure electron transfer capacity and structural analyses using circular dichroism or, if possible, X-ray crystallography or cryo-EM.

How can I design effective RT-PCR experiments to study ndhE gene expression patterns?

Designing effective RT-PCR experiments for ndhE expression analysis requires careful consideration of several factors:

  • RNA Extraction: Use a CTAB RNA isolation protocol as demonstrated successful for carrot tissues . Divide nucleic acids equally for serial DNase I and RNase A treatments to ensure purity. Purify RNAs using appropriate kits (such as RNeasy Mini Kit).

  • Quality Control: Estimate nucleic acid concentrations using sensitive assays like Qubit High Sensitivity DNA and RNA assays . Perform gel electrophoresis to verify RNA integrity.

  • cDNA Synthesis: Use approximately 1 μg RNA for reverse transcription with a reliable first-strand synthesis kit (e.g., Maxima First Stand Synthesis Kit) .

  • Primer Design: Design gene-specific primers for ndhE that span exon-exon junctions to prevent amplification from any residual DNA. Include primers for reference genes appropriate for normalizing expression in carrot tissue.

  • Controls: Include multiple experimental controls :

    • No-template controls

    • No-reverse transcriptase controls

    • Positive controls using known templates

    • DNA inputs to verify primer specificity

  • Data Analysis: Use the 2^-ΔΔCt method for relative quantification, ensuring appropriate statistical analysis of biological replicates.

This methodological approach ensures robust and reproducible results when studying ndhE expression patterns across different tissues or developmental stages.

What genome editing approaches are most suitable for studying ndhE function in carrots?

When considering genome editing to study ndhE function in carrots, researchers have several options:

  • CRISPR-Cas9 System: This is particularly useful for creating knockout or knockdown mutations. For chloroplast genes like ndhE, plastid transformation would be required, as standard nuclear transformation wouldn't affect the chloroplast genome. Design guide RNAs targeting unique regions of ndhE, avoiding regions with potential off-target effects.

  • Transplastomic Approaches: Given that ndhE is in the chloroplast genome, transplastomic methods that directly modify the chloroplast genome are most appropriate. This typically involves homologous recombination with a vector containing modified ndhE sequences flanked by homologous regions.

  • RNA Interference (RNAi): While less precise than CRISPR, RNAi can be effective for reducing ndhE expression levels, particularly if complete knockout is lethal. Construct hairpin RNA structures targeting unique regions of ndhE mRNA.

  • Validation Strategies: Regardless of the editing approach, comprehensive validation is essential:

    • PCR and sequencing to confirm genetic modifications

    • RT-PCR to assess changes in expression levels

    • Western blot analysis to verify protein level changes

    • Physiological assays to measure photosynthetic parameters

How should researchers interpret contradictory results in ndhE functional studies?

When encountering contradictory results in ndhE functional studies, researchers should implement a systematic approach to reconciliation:

  • Experimental Conditions Assessment: Carefully evaluate differences in experimental conditions that might explain divergent results. Minor variations in light intensity, temperature, or humidity can significantly affect photosynthetic protein function and expression. Document all environmental parameters thoroughly.

  • Genetic Background Consideration: The carrot T2T genome has revealed extensive genetic diversity, with multiple copies of many genes involved in important metabolic pathways . Different carrot cultivars may have variations in ndhE sequence or regulatory elements that explain functional differences.

  • Methodological Comparison: Analyze methodological differences between studies, including:

    • Protein isolation techniques

    • Activity assay conditions

    • RNA extraction and quantification methods

    • Statistical approaches

  • Integrated Analysis Framework: Apply a multi-omics approach to understand contradictions. For example, integrate transcriptomic data on ndhE expression with proteomic data on NDH complex composition and metabolomic data on energetic status. This holistic view often reveals that contradictions reflect different aspects of a complex biological reality.

  • Hypothesis Refinement: Develop new hypotheses that explain apparent contradictions, potentially involving regulatory mechanisms, protein modifications, or context-dependent functionality. Design targeted experiments to test these refined hypotheses.

Through this systematic approach, researchers can transform contradictory results into deeper insights about the contextual function of ndhE in carrot photosynthesis.

What statistical approaches are most appropriate for analyzing ndhE expression data across developmental stages?

For analyzing ndhE expression across developmental stages, several statistical approaches are appropriate:

  • Longitudinal Data Analysis: Since developmental studies involve repeated measurements over time, use repeated measures ANOVA or mixed-effects models to account for within-subject correlations. This is particularly important when analyzing expression patterns similar to those observed in carotenoid accumulation studies in carrots, where significant changes occur throughout development .

  • Time Series Analysis: For fine-grained developmental studies, time series analysis can identify temporal patterns, including cyclic variations that might correlate with diurnal rhythms or developmental transitions.

  • Multivariate Approaches: When analyzing ndhE expression alongside other genes or metabolites:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Hierarchical clustering to identify co-expressed genes

    • Partial Least Squares Discriminant Analysis (PLS-DA) to identify variables that discriminate between developmental stages

  • Normalization Considerations: For RT-PCR data, evaluate multiple reference genes for stability across developmental stages using algorithms like geNorm or NormFinder. Select the most stable references for accurate normalization.

  • Visualization Techniques: Heat maps combined with hierarchical clustering can effectively visualize expression patterns across developmental stages and tissues, similar to approaches used in comprehensive genomic studies .

The appropriate statistical approach will ultimately depend on the experimental design, sample size, and specific research questions, but should always include rigorous testing of statistical assumptions and appropriate multiple testing corrections.

How can researchers effectively integrate data from genomics, transcriptomics, and proteomics studies of ndhE?

Effective integration of multi-omics data for ndhE research requires a structured approach:

  • Data Harmonization: Ensure compatible sample preparation and data collection across platforms. When possible, use the same biological samples for different omics analyses to minimize biological variation.

  • Genomic Foundation: Start with the genomic context of ndhE from high-quality genome assemblies like the carrot T2T genome, which provides complete chromosome-level information with telomeric and centromeric regions . Analyze the surrounding genomic landscape for potential regulatory elements.

  • Transcriptomic Layer: Map transcriptomic data to the genomic foundation, analyzing ndhE expression patterns across conditions and tissue types. Identify co-expressed genes that may function in related processes.

  • Proteomic Dimension: Analyze ndhE protein abundance, post-translational modifications, and protein-protein interactions within the NDH complex. Correlation with transcriptomic data can reveal post-transcriptional regulatory mechanisms.

  • Integration Tools:

    • Network analysis to identify functional modules

    • Pathway enrichment to place ndhE in biological context

    • Machine learning approaches to identify patterns across omics layers

  • Validation Strategy: Design targeted experiments to validate predictions from integrated analyses, such as testing predicted protein interactions or regulatory relationships.

This integrated approach has proven powerful in understanding complex biological processes, as demonstrated in carrot research where genomic information has enhanced understanding of metabolic pathways like carotenoid biosynthesis .

How does ndhE function contribute to stress response mechanisms in Daucus carota?

The NAD(P)H dehydrogenase complex, of which ndhE is a component, plays significant roles in plant stress responses, particularly under conditions that challenge photosynthetic efficiency:

  • High Light Stress Response: The NDH complex contributes to cyclic electron flow around Photosystem I, which increases ATP production without additional NADPH generation. This helps balance the ATP:NADPH ratio under high light conditions when linear electron flow may produce excess reducing power. Studying ndhE function under varying light intensities would require carefully controlled growth chamber experiments with photosynthetic parameter measurements.

  • Drought Tolerance Mechanisms: During drought, the NDH complex helps maintain photosynthetic function by preventing over-reduction of the electron transport chain. Researchers should design experiments with controlled soil moisture levels, measuring both ndhE expression and photosynthetic parameters like non-photochemical quenching.

  • Temperature Stress Adaptation: The NDH complex contributes to thermal tolerance in chloroplasts. Experimental approaches should include temperature gradient treatments, monitoring both short-term responses and acclimation processes.

  • Integration with Metabolic Pathways: In carrots specifically, stress responses must be considered in the context of root development and carotenoid accumulation. The significant changes in carotenoid content observed during root development (increasing more than eightfold to reach 2.71 mg/g dry weight by 90 days after sowing) suggest complex regulatory networks that may interact with photosynthetic stress responses.

  • Experimental Design Considerations: When studying ndhE's role in stress responses, researchers should combine gene expression analysis (using RT-PCR protocols with appropriate controls) with physiological measurements of photosynthetic parameters and metabolomic profiling of energy-related compounds.

This integrated approach will provide insights into how ndhE contributes to carrot stress resilience across various environmental challenges.

What role might ndhE play in the regulation of carotenoid biosynthesis in carrot roots?

While direct evidence linking ndhE to carotenoid biosynthesis is not presented in the search results, there are several potential mechanisms through which this chloroplastic protein might influence carotenoid accumulation in carrot roots:

  • Energy Balance Influence: As part of the NDH complex involved in cyclic electron flow, ndhE contributes to ATP generation. Carotenoid biosynthesis is an energy-intensive process, requiring ATP for several steps. The energy balance maintained partly through NDH function could indirectly influence carotenoid synthesis rates.

  • Redox Signaling Pathways: The NDH complex contributes to maintaining chloroplast redox status, which generates signaling molecules that can communicate between chloroplasts and other plastids, potentially including chromoplasts in carrot roots where carotenoids accumulate.

  • Experimental Approaches: To investigate potential connections, researchers could:

    • Create ndhE variants through chloroplast transformation techniques

    • Measure impacts on photosynthetic parameters and energy status

    • Analyze downstream effects on root carotenoid content using HPLC techniques similar to those used to measure lutein, α-carotene, and β-carotene in carrot developmental studies

    • Examine expression correlations between ndhE and carotenoid pathway genes like PSY, PDS, CRTISO, LCYE, and BCH

  • Regulatory Network Analysis: The carrot genome contains 65 genes identified as structural genes in the carotenoid metabolic pathway . Researchers should analyze potential regulatory links between photosynthetic function (influenced by ndhE) and this pathway, particularly focusing on transcription factors that might respond to chloroplast energy or redox status.

This research direction could reveal novel connections between photosynthetic function and the nutritionally important carotenoid accumulation in carrot roots.

What emerging technologies will advance our understanding of ndhE structure and function?

Several cutting-edge technologies are poised to revolutionize our understanding of ndhE:

  • Cryo-Electron Microscopy (Cryo-EM): This technology has transformed structural biology by allowing visualization of large protein complexes in near-native states. For the NDH complex containing ndhE, cryo-EM could reveal precise structural arrangements and conformational changes during electron transfer, providing insights impossible with crystallography alone.

  • Single-Molecule Techniques: Methods like single-molecule FRET can track dynamic processes in real-time, potentially revealing transient states in ndhE function during electron transfer events. These approaches require specialized fluorescent labeling but offer unprecedented temporal resolution.

  • Long-Read Sequencing Technologies: The success of technologies like ONT Ultra-long and PacBio HiFi in generating the carrot T2T genome with significantly improved contiguity (contig N50 of 45.71 Mb compared to 31.23 Mb in the previous version) demonstrates their value for genomic context studies. These technologies can resolve complex regions surrounding genes like ndhE and identify structural variations across carrot varieties.

  • Spatial Transcriptomics: These emerging methods can map gene expression patterns with subcellular resolution, potentially revealing micro-heterogeneity in ndhE expression across different chloroplast populations within a single cell or tissue.

  • CRISPR-Based Techniques for Chloroplast Genome Editing: While still developing, precise editing tools for the chloroplast genome would allow functional dissection of ndhE through targeted mutations, potentially creating allelic series to study structure-function relationships.

Researchers should consider how these technologies could be integrated into comprehensive research programs on ndhE, potentially revealing new aspects of its function in photosynthesis and plant metabolism.

How can comparative genomics approaches enhance our understanding of ndhE evolution in the Apiaceae family?

Comparative genomics offers powerful approaches to understand ndhE evolution within Apiaceae:

  • Phylogenetic Analysis Framework: Building on the high-quality carrot T2T genome , researchers should:

    • Extract ndhE sequences from multiple Apiaceae species

    • Construct phylogenetic trees using maximum likelihood methods

    • Map functional domains onto the phylogeny to identify conserved regions

    • Calculate selection pressures using dN/dS ratios to detect signatures of positive or purifying selection

  • Structural Variation Analysis: Beyond sequence evolution, structural variations in the genomic region containing ndhE may reveal important evolutionary events:

    • Analyze synteny across Apiaceae chloroplast genomes

    • Identify genomic rearrangements that may have affected ndhE regulation

    • Detect chloroplast genome inversions or duplications through whole-genome alignments

  • Transposon Analysis: The carrot genome contains diverse transposons, including LTR-Copia, LTR-Gypsy, LTR-MULE, and LTR-hAT, some of which have been found near genes involved in metabolic pathways . Similar analysis of regions surrounding ndhE across Apiaceae could reveal the impact of transposable elements on ndhE evolution.

  • Integration with Ecological Data: Correlating ndhE sequence or structural variations with ecological niches of different Apiaceae species could reveal adaptations to specific environmental conditions, particularly those affecting photosynthetic function.

This evolutionary perspective would provide context for functional studies and potentially identify natural variants with altered function that could inform biotechnological applications.

What are the most significant recent advances in our understanding of ndhE in Daucus carota?

Recent advances in carrot genomics and biochemistry have significantly enhanced our understanding of chloroplastic proteins like ndhE:

  • Genomic Context Resolution: The development of the telomere-to-telomere carrot genome assembly has provided unprecedented resolution of the complete genomic context, with a genome size of 430.40 Mb, contig N50 of 45.71 Mb, and complete resolution of all 9 chromosomes including telomeric and centromeric regions . This high-quality reference enhances our ability to study the genomic environment of chloroplast genes like ndhE.

  • Methodological Advancements: Improved protocols for RNA extraction, such as CTAB-based methods with careful DNase and RNase treatments, along with sensitive quantification techniques like Qubit assays, have enhanced our ability to study expression patterns of genes like ndhE .

  • Integration with Metabolic Pathways: Our understanding of how photosynthetic electron transport (involving ndhE) connects with important metabolic pathways has advanced, particularly regarding carotenoid biosynthesis in carrots, where 65 structural genes have been identified and characterized .

  • Biotechnological Applications: Advances in recombinant protein expression, including optimization based on codon usage and incorporation of appropriate targeting peptides, have enhanced our ability to produce and study chloroplastic proteins .

These advances collectively provide a stronger foundation for future research on ndhE structure, function, and evolution in Daucus carota, potentially leading to applications in crop improvement or biotechnology.

What are the key unresolved questions about ndhE that require further investigation?

Despite significant advances, several critical questions about ndhE remain unresolved:

  • Structure-Function Relationships: The precise structural elements of ndhE that determine its function within the NDH complex remain poorly characterized. High-resolution structural studies are needed to understand how this subunit contributes to electron transfer and complex stability.

  • Regulatory Mechanisms: The factors controlling ndhE expression in different tissues and developmental stages are not fully understood. Investigations of transcription factors, epigenetic modifications, and post-transcriptional regulation would provide valuable insights.

  • Environmental Response Dynamics: While the NDH complex is known to function in stress responses, the specific role of ndhE in adapting to changing environmental conditions, particularly in the context of climate change, requires further investigation.

  • Metabolic Network Integration: The potential connections between ndhE function and important metabolic pathways in carrots, particularly carotenoid biosynthesis, represent an intriguing area for future research.

  • Evolutionary Adaptations: Comparative studies across diverse plant species could reveal how ndhE has evolved to support photosynthesis in different ecological niches and environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.