Recombinant Daucus carota NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Biological Role of ndhG

ndhG encodes a subunit of the chloroplast NAD(P)H dehydrogenase (NDH) complex, which facilitates cyclic electron transport around photosystem I (PSI) and chlororespiratory pathways . This membrane-bound protein contributes to:

  • Electron transfer between NAD(P)H and plastoquinone

  • Stress adaptation under high-light conditions

  • ATP synthesis via proton gradient generation

Recombinant Production Protocols

Standard methodologies for plant ndhG expression include:

  • Expression system: E. coli BL21(DE3) with pET vectors

  • Purification: Ni-NTA affinity chromatography (>90% purity via SDS-PAGE)

  • Stabilization: Lyophilization with 6% trehalose in Tris/PBS buffer (pH 8.0)

Critical parameters:

  • Optimal reconstitution at 0.1–1.0 mg/mL in sterile water

  • 50% glycerol recommended for long-term storage at -80°C

Functional Validation

Key experimental approaches for characterizing recombinant ndhG:

  • Circular dichroism: Confirms α-helical content matches native conformations

  • BN-PAGE: Verifies integration into 550 kDa NDH complexes

  • Immunoblotting: Uses anti-His/NdhH antibodies for complex detection

Research Gaps and Challenges

  • Expression challenges: Low yield (0.3–0.7 mg/L culture)

  • Stability issues: 40% activity loss after 3 freeze-thaw cycles

  • Glycosylation mismatch: Recombinant proteins show 5–8% MW reduction vs native forms

Comparative Genomic Insights

Phylogenetic analysis of ndhG reveals:

  • 72–89% sequence identity across angiosperms

  • C4 plants show 1.6–3× higher expression vs C3 species

  • Vascular bundle sheath localization in NADP-ME-type species

Future Research Directions

Priority areas for Daucus carota ndhG characterization:

  1. Heterologous expression in chloroplast transformation systems

  2. Cryo-EM structural analysis at <3.5Å resolution

  3. Functional complementation studies in ndhG knockout lines

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize the development of that specific tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSHFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGVTSMVCTSIFVSLITTIPDTSW YGIIWTTKSNQIVEQDLISNSQQIGIHLSTDFFLPFELISIILLVSLIGAITVARQ
Uniprot No.

Target Background

Function
NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. The enzyme couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the chloroplast NAD(P)H dehydrogenase complex in Daucus carota and what role does the ndhG subunit play?

The chloroplast NAD(P)H dehydrogenase (NDH) complex is a multi-subunit protein complex involved in photosystem I (PSI) cyclic and chlororespiratory electron transport in higher plants, including Daucus carota (carrot) . The ndhG gene encodes one of the essential membrane subunits of this complex. Within the NDH complex, ndhG functions as part of the core machinery that catalyzes NAD(P)H-dependent plastoquinone reduction.

The NDH complex has been shown to interact with PSI to form a novel supercomplex, as demonstrated through blue native PAGE analysis . This interaction is critical for efficient cyclic electron flow around PSI, which generates ATP without producing NADPH, helping plants balance their ATP/NADPH ratio according to metabolic demands.

How is the ndhG gene expressed during carrot development and chloroplast biogenesis?

During the greening process, the NDH complex initially exists primarily as a monomer. After 24 hours of illumination, a small portion shifts to form the NDH-PSI supercomplex, which becomes fully assembled after 48 hours of continuous illumination . This temporal pattern suggests that ndhG expression and incorporation into the functional complex is regulated during chloroplast biogenesis.

What techniques are used to clone and express recombinant ndhG from Daucus carota?

For cloning and expressing recombinant ndhG from Daucus carota, researchers typically employ polymerase chain reaction (PCR) strategies similar to those used for other carrot genes. Based on established protocols for related proteins, the recommended approach includes:

  • RNA extraction from carrot chloroplasts using plant RNA isolation kits

  • cDNA synthesis via reverse transcription

  • Gene-specific primer design based on the Daucus carota genome sequence

  • PCR amplification of the ndhG coding sequence

  • Cloning into appropriate expression vectors (e.g., pET series for E. coli)

For protein expression, both prokaryotic (Escherichia coli) and eukaryotic (Pichia pastoris) systems have been successfully used for other carrot proteins . E. coli is often preferred for initial studies due to its simplicity and high yield, while the yeast system may better accommodate proteins requiring post-translational modifications .

What are the optimal conditions for functional analysis of recombinant Daucus carota ndhG protein?

Functional analysis of recombinant ndhG requires careful attention to experimental conditions that preserve the native structure and activity of the protein. Based on research with similar proteins, the following methodological considerations are critical:

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using histidine tags

  • Size exclusion chromatography to obtain homogeneous protein preparations

  • Detergent selection critical for membrane protein stability (commonly DDM or digitonin)

Activity Assay Conditions:

  • Buffer composition: 50 mM Tris-HCl (pH 7.5), 100 mM NaCl, 5 mM MgCl₂

  • Temperature: 25-30°C for optimal activity

  • Electron donors: NADH or NADPH at 100-200 μM

  • Electron acceptors: Ubiquinone analogs (50-100 μM)

Data Analysis Parameters:

ParameterMeasurement MethodTypical Range for NDH Subunits
Km for NADHSpectrophotometric10-50 μM
Km for NADPHSpectrophotometric30-100 μM
VmaxInitial rate analysis0.5-2 μmol/min/mg
pH optimumActivity profilingpH 7.0-8.0
Temperature stabilityThermal shift assay20-40°C

When interpreting functional data, researchers should account for the membrane-embedded nature of ndhG and its dependency on other NDH subunits for full functionality.

How can researchers accurately assess the integration of recombinant ndhG into the NDH-PSI supercomplex?

Assessing the proper integration of recombinant ndhG into the NDH-PSI supercomplex requires sophisticated biochemical and biophysical techniques. Based on established research protocols , the following methodological approach is recommended:

  • Blue Native PAGE Analysis:

    • Solubilize thylakoid membranes with mild detergents (digitonin or n-dodecyl β-D-maltoside)

    • Separate native complexes on 4-12% gradient gels

    • Identify the NDH-PSI supercomplex at approximately 1000 kDa

    • Confirm presence of ndhG via immunoblotting or mass spectrometry

  • Sucrose Density Gradient Ultracentrifugation:

    • Layer solubilized thylakoid membranes on 0.1-1.3 M sucrose gradients

    • Centrifuge at 280,000g for 16 hours at 4°C

    • Collect fractions and analyze by immunoblotting with anti-ndhG antibodies

    • Co-migration with PSI subunits confirms supercomplex formation

  • Two-dimensional electrophoresis:

    • First dimension: Blue-native PAGE

    • Second dimension: SDS-PAGE

    • Immunoblot analysis using antibodies against ndhG and PSI components (e.g., PsaA)

The successful incorporation of ndhG is indicated by its co-migration with both NDH complex components and PSI subunits in a high molecular weight supercomplex .

What strategies can be employed to investigate the structure-function relationship of ndhG using site-directed mutagenesis?

Site-directed mutagenesis provides powerful insights into structure-function relationships of ndhG. A systematic approach should include:

Target Selection Strategy:

  • Conserved residues identified through multiple sequence alignment across plant species

  • Charged residues potentially involved in protein-protein interactions

  • Putative quinone-binding sites based on homology modeling

  • Transmembrane domain boundaries for membrane integration studies

Recommended Mutagenesis Protocol:

  • Use overlap extension PCR or QuikChange methodology

  • Generate alanine scanning mutants for initial screening

  • Create conservative and non-conservative substitutions at key positions

  • Include epitope or fluorescent tags for localization studies

Functional Assessment Framework:

Mutation TypeExperimental AnalysisExpected Outcome
Catalytic siteEnzyme kineticsAltered Km or Vmax
Membrane anchorMembrane integration assaysDefective complex assembly
Interaction interfaceCo-immunoprecipitationReduced supercomplex formation
Regulatory sitesPhosphorylation assaysModified activity regulation

Researchers should employ complementation studies in ndhG knockout plants to validate the physiological significance of specific mutations . Electron transport measurements and growth phenotype analysis under various light conditions provide further functional insights.

How can researchers address challenges in expressing recombinant membrane proteins like ndhG?

Membrane proteins such as ndhG present significant expression challenges due to their hydrophobicity and complex folding requirements. Based on research experience with similar proteins, the following strategies can mitigate common issues:

Expression System Selection:

  • E. coli C41(DE3) or C43(DE3) strains specifically developed for membrane proteins

  • Cell-free expression systems to avoid toxicity issues

  • Inclusion of chaperones (GroEL/GroES) to assist proper folding

Fusion Tag Strategies:

  • N-terminal fusion with maltose-binding protein (MBP) to enhance solubility

  • C-terminal His6-tag for purification while minimizing interference with membrane integration

  • SUMO tag for improved expression and folding, removable with SUMO protease

Solubilization Protocol Optimization:

  • Screen multiple detergents (DDM, LDAO, Brij-35) at various concentrations

  • Test mixed micelle systems (combination of primary and secondary detergents)

  • Evaluate amphipols or nanodiscs for stable membrane protein extraction

Troubleshooting Guide:

ProblemPossible CauseSolution
Low expressionToxicity to hostReduce induction temperature to 16°C
Inclusion bodiesImproper foldingCo-express with molecular chaperones
DegradationProtease activityAdd protease inhibitors, use protease-deficient strains
Inactive proteinDetergent interferenceTry milder detergents or lipid supplementation

When designing expression constructs, researchers should consider the natural processing of the chloroplast transit peptide, as improper processing may affect protein folding and function .

What are the key considerations for designing experiments to study ndhG interactions with other NDH complex subunits?

Investigating protein-protein interactions within the NDH complex requires careful experimental design. Based on published methodologies for studying similar complexes , consider the following approach:

Yeast Two-Hybrid Analysis:

  • Create baits and preys for ndhG and other NDH subunits

  • Screen for binary interactions to identify direct binding partners

  • Validate positive hits with reverse configurations

  • Map interaction domains through truncation constructs

Co-immunoprecipitation Studies:

  • Generate antibodies against ndhG or use epitope-tagged versions

  • Solubilize thylakoid membranes under conditions preserving protein complexes

  • Perform pull-down assays followed by immunoblotting or mass spectrometry

  • Include appropriate controls to distinguish specific from non-specific interactions

In vivo Protein Complementation Assays:

  • Split-fluorescent protein methods (BiFC) for visualizing interactions

  • Ensure proper chloroplast targeting of fusion constructs

  • Include both positive and negative interaction controls

  • Perform competition assays with untagged proteins to verify specificity

Data Interpretation Framework:

MethodStrengthLimitationComplementary Approach
Y2HDetects direct interactionsMay miss membrane protein interactionsMembrane Y2H system
Co-IPPreserves native complexesCan detect indirect interactionsCrosslinking MS
BiFCVisualizes in vivo interactionsIrreversible complex formationFRET analysis
BN-PAGEMaintains native complexesLimited resolution of subcomplex interactionsSucrose gradient fractionation

Researchers should integrate multiple complementary approaches to build a comprehensive interaction map of ndhG within the NDH complex .

How can CRISPR-Cas9 genome editing be applied to study ndhG function in Daucus carota?

CRISPR-Cas9 technology offers powerful approaches for functional genomics of ndhG in carrots. Based on established protocols for plant genome editing, researchers should consider:

Guide RNA Design Strategy:

  • Target ndhG-specific sequences with minimal off-target potential

  • Design multiple gRNAs targeting different exons

  • Include gRNAs for promoter region modification to study expression regulation

  • Design repair templates for precise modifications or tagged versions

Delivery Methods for Carrot Transformation:

  • Agrobacterium-mediated transformation of carrot callus

  • Protoplast transfection for transient expression

  • Particle bombardment for direct DNA delivery

  • In planta transformation through flower dipping (if applicable)

Verification and Phenotyping Framework:

Modification TypeVerification MethodPhenotypic Analysis
KnockoutSequencing, immunoblottingPhotosynthetic parameters, growth measurement
Point mutationsRFLP, sequencingEnzyme activity, complex assembly
Promoter editingRT-qPCR, reporter assaysExpression patterns, stress responses
Epitope taggingImmunoblotting, microscopyProtein localization, interaction studies

When interpreting results from ndhG-edited plants, researchers should account for the recombinant DNA guidelines outlined by regulatory bodies . Control experiments should include wild-type plants and plants with modifications in non-NDH genes to distinguish specific effects.

What bioinformatic approaches can reveal evolutionary conservation and specialized functions of ndhG across plant species?

Comparative genomics and bioinformatics provide valuable insights into ndhG evolution and specialization. A comprehensive analytical framework includes:

Sequence Analysis Pipeline:

  • Retrieve ndhG sequences from diverse plant species, including monocots, dicots, and lower plants

  • Perform multiple sequence alignment using MUSCLE or T-Coffee algorithms

  • Calculate conservation scores for each amino acid position

  • Identify taxa-specific variations that may relate to environmental adaptations

Structural Bioinformatics Approach:

  • Generate homology models based on available structures of bacterial NDH homologs

  • Predict transmembrane topology using TMHMM or Phobius

  • Map conserved residues onto structural models to identify functional domains

  • Perform molecular dynamics simulations to assess structural stability

Evolutionary Analysis Methods:

Analysis TypeSoftware ToolBiological Insight
Phylogenetic reconstructionRAxML, MrBayesEvolutionary history of ndhG
Selection pressure analysisPAML, HyPhySites under positive/negative selection
Coevolution analysisCAPS, DCAResidues coevolving within protein networks
Synteny analysisMCScanXGenomic context conservation

Through integrative bioinformatic analysis, researchers can identify conserved functional domains and species-specific adaptations in the ndhG protein that correlate with environmental conditions or photosynthetic strategies across plant lineages.

How might advances in cryo-electron microscopy contribute to understanding the structural role of ndhG in the NDH-PSI supercomplex?

Recent advances in cryo-electron microscopy (cryo-EM) offer unprecedented opportunities for elucidating the structural details of membrane protein complexes like NDH-PSI. Researchers interested in ndhG should consider:

Sample Preparation Strategy:

  • Isolate intact chloroplasts from Daucus carota leaves using differential centrifugation

  • Extract thylakoid membranes and solubilize with gentle detergents (digitonin preferred)

  • Purify NDH-PSI supercomplex using sucrose gradient ultracentrifugation

  • Apply to cryo-EM grids with thin carbon support films

Data Collection Parameters:

  • Use high-end electron microscopes (300 kV) with direct electron detectors

  • Collect images with minimal dose to reduce radiation damage

  • Implement movie mode recording for drift correction

  • Acquire data at various defocus values for CTF correction

Structural Analysis Workflow:

Analysis StepMethodologyExpected Outcome
Particle pickingReference-free autopicking100,000+ supercomplex particles
2D classificationMaximum likelihoodClass averages revealing complex views
3D reconstructionSingle particle analysis3-4 Å resolution structure
Model buildingDe novo/homology modelingAtomic model of ndhG within complex

The resulting structural data would reveal the precise position of ndhG within the supercomplex, its interactions with other subunits, and potential functional domains involved in electron transport . This information would guide future mutagenesis studies and provide insights into the molecular mechanism of NDH complex activity.

What role might ndhG play in enhancing stress tolerance in engineered crop plants?

Understanding the role of ndhG in stress responses could inform genetic engineering strategies for crop improvement. Based on the known functions of the NDH complex, researchers should explore:

Stress Response Analysis Protocol:

  • Compare ndhG expression levels under various stresses (drought, high light, temperature)

  • Characterize photosynthetic parameters in wild-type vs. ndhG-modified plants under stress

  • Measure reactive oxygen species production and antioxidant capacity

  • Assess energy balance through ATP/NADPH ratio determination

Engineering Strategies for Enhanced Stress Tolerance:

  • Overexpression of ndhG under stress-inducible promoters

  • Introduction of ndhG variants from stress-tolerant plant species

  • Co-expression of ndhG with other NDH subunits to enhance complex stability

  • Fine-tuning of expression using synthetic promoters or UTR modifications

Performance Evaluation Framework:

ParameterMeasurement TechniqueExpected Improvement
Photoinhibition resistanceChlorophyll fluorescenceReduced PSII damage under high light
Water use efficiencyGas exchange analysisImproved CO₂ fixation per water transpired
Heat toleranceThermotolerance assaysMaintained photosynthesis at elevated temperatures
Recovery from stressTime-course analysisFaster restoration of photosynthetic capacity

When designing ndhG modification strategies, researchers must follow established guidelines for recombinant DNA research , particularly regarding environmental risk assessment and containment procedures for field trials with modified plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.