Recombinant Daucus carota Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Daucus carota Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered protein derived from the CP47 subunit of Photosystem II (PSII) in carrots (Daucus carota). CP47 is a critical chlorophyll-binding antenna protein that facilitates light harvesting and energy transfer in PSII, a key complex in photosynthetic electron transport . The recombinant form enables detailed biochemical and structural studies of PSII assembly, function, and interactions in plant systems .

Role in Photosystem II Assembly

CP47 forms preassembled pigment-protein complexes in vivo before integration into PSII. Studies in Synechocystis sp. PCC 6803 reveal CP47 co-purifies with auxiliary subunits (PsbH, PsbL, PsbT), highlighting its role in stabilizing early PSII intermediates .

Functional Insights

  • Chlorophyll Binding: Structural models predict 14 chlorophyll molecules per CP47 monomer, with five histidine residues directly coordinating Mg²⁺ ions .

  • Carotenoid Interactions: β-carotene stabilizes CP47’s structure and mitigates photooxidative damage .

Biotechnological Applications

  • ELISA Kits: Recombinant CP47 is used in immunodetection assays to study PSII dynamics .

  • Transient Expression Systems: Agroinfiltration of CP47-containing constructs in apple and tomato enhances carotenoid biosynthesis, demonstrating its utility in metabolic engineering .

Comparative Analysis of Production Systems

Host SystemAdvantagesLimitations
E. coliCost-effective, high yield Lack of post-translational modifications
Mammalian CellsProper folding, eukaryotic modificationsHigher cost, lower yield

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; glycerol stabilization is recommended .

  • Structural Resolution: Current models (e.g., 8 Å resolution) require refinement to map chlorophyll orientations accurately .

  • Agricultural Applications: Transient expression of CP47-linked constructs could improve crop photoprotection and nutritional profiles .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag, please inform us, and we will strive to incorporate it during development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITSSWGGWSITGGATPNPGIWSYEGVAGAHIVFSGLCFLAAIWHWTYWDL AIFCDERTGKPSLDLPKIFGIHLFLAGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQTV
Uniprot No.

Target Background

Function
CP47, a chlorophyll apoprotein, is a crucial component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a pivotal role in catalyzing the initial light-induced photochemical reactions within PSII. PSII, a light-driven water:plastoquinone oxidoreductase, harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem II CP47 chlorophyll apoprotein and what is its role in photosynthesis?

The Photosystem II CP47 chlorophyll apoprotein (psbB) is a core antenna chlorophyll binding subunit of Photosystem II (PSII). It plays a crucial role in light harvesting and energy transfer within the photosynthetic apparatus. Based on studies in model organisms like Arabidopsis thaliana, CP47 is essential for proper PSII function, serving as one of the principal chlorophyll-binding proteins in the PSII core complex .

CP47 is synthesized only after D1 has successfully assembled with D2 in the PSII reaction center. Its recruitment to form the PSII core complex facilitates the subsequent binding of the oxygen evolving enhancer (OEE) proteins . In the functional PSII complex, CP47 and CP43 are closely associated with the reaction center but positioned on opposite sides of the complex, working together to optimize light harvesting and electron transfer from water to plastoquinone during photosynthesis .

With an approximate molecular weight of 56.0 kD (derived from nucleotide sequence analysis), CP47 is localized in the chloroplast thylakoid membrane where it performs its photosynthetic functions .

What expression systems are most effective for producing functional recombinant CP47?

For the recombinant expression of photosynthetic proteins like CP47, several expression systems can be considered, each with specific advantages for different research objectives:

Bacterial Expression Systems:
While bacterial systems like E. coli offer rapid growth and high protein yields, they often struggle with proper folding and post-translational modifications of complex membrane proteins like CP47. If using bacterial systems, specialized strains designed for membrane protein expression and inclusion of chaperones may improve results.

Plant-Based Expression:
For photosynthetic proteins, homologous expression in plant systems often provides better functional fidelity. Based on approaches used for similar proteins, techniques like Agrobacterium-mediated transformation can be effective. From search result , we can see that Agrobacterium tumefaciens (GV3101 strain) has been successfully used for transformation experiments involving photosynthetic genes in plants .

Cell-Free Expression Systems:
These systems can be advantageous for membrane proteins as they allow direct incorporation into liposomes or nanodiscs during synthesis, potentially improving folding and stability.

When expressing recombinant CP47, researchers should consider including its native transit peptide for proper chloroplast targeting if using in vivo systems, or design constructs with appropriate solubilization tags if using in vitro approaches.

What methods are recommended for purification and stabilization of recombinant CP47?

Purification of recombinant CP47 requires specialized approaches due to its membrane-embedded nature and complex structure with multiple chlorophyll binding sites:

  • Membrane Solubilization: Gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are typically effective for solubilizing thylakoid membrane proteins while preserving structure and function.

  • Chromatography Techniques: A multi-step purification approach is recommended:

    • Immobilized metal affinity chromatography (IMAC) if the recombinant protein contains a histidine tag

    • Ion exchange chromatography to separate based on charge properties

    • Size exclusion chromatography for final polishing and buffer exchange

  • Stabilization Strategies:

    • Maintain physiological pH (typically pH 6.5-7.5)

    • Include glycerol (10-20%) to enhance protein stability

    • Add specific lipids that associate with CP47 in its native environment

    • Consider using amphipols or nanodiscs for long-term stability studies

According to product information, proper storage conditions are critical for maintaining shelf life of the purified protein, with factors including buffer composition and temperature playing important roles .

How can researchers verify the functional integrity of recombinant CP47?

Verification of functional integrity for recombinant CP47 should include multiple complementary approaches:

Spectroscopic Analysis:

  • Absorption spectroscopy to confirm chlorophyll binding (characteristic peaks at ~440 nm and ~680 nm)

  • Circular dichroism to assess secondary structure integrity

  • Fluorescence measurements to evaluate energy transfer capability

Binding Assays:

  • Chlorophyll binding capacity assessment

  • Interaction studies with other PSII components (particularly D1, D2, and CP43)

Structural Validation:

  • Limited proteolysis to confirm proper folding

  • Cross-linking studies to verify expected protein-protein interactions

Functional Reconstitution:

  • Assembly with other PSII components to assess formation of functional complexes

  • Electron transfer measurements in reconstituted systems

If the recombinant protein demonstrates expected spectral properties, appropriate binding characteristics, and can participate in functional PSII assembly, it can be considered functionally intact.

How can recombinant CP47 be used to study PSII assembly and function?

Recombinant CP47 provides valuable opportunities for detailed investigation of PSII assembly mechanisms and functional properties:

Assembly Studies:
Research has shown that CP47 is made only after D1 has successfully assembled with D2, making it an excellent marker for PSII assembly progression . Recombinant CP47 can be used in reconstitution experiments to determine:

  • The order and kinetics of component assembly

  • Critical interaction interfaces between subunits

  • Factors affecting assembly efficiency and stability

Functional Studies:

  • Mutagenesis of specific chlorophyll-binding residues to map energy transfer pathways

  • Investigation of CP47's role in oxygen evolution through reconstitution experiments

  • Studies of CP47's interaction with PAM68 and other assembly factors

Structural Biology Applications:

  • Providing material for crystallization trials or cryo-EM studies

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • FRET-based studies to determine distances between functional domains

By using recombinant CP47 as an experimental tool, researchers can manipulate specific aspects of the protein (through mutations or selective labeling) that would be difficult to accomplish in the native complex.

What approaches are effective for studying CP47-protein interactions?

Several complementary approaches can be employed to study CP47's interactions with other photosystem components:

In vitro Binding Assays:

  • Pull-down assays using tagged recombinant CP47

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

Crosslinking and Mass Spectrometry:

  • Chemical crosslinking followed by mass spectrometry analysis

  • Zero-length crosslinkers to identify direct interaction sites

  • Photo-reactive amino acid analogs for highly specific crosslinking

Fluorescence-Based Techniques:

  • FRET measurements between labeled protein pairs

  • Fluorescence correlation spectroscopy for dynamic interactions

  • Bimolecular fluorescence complementation in vivo

How does heteroplasmy affect CP47 function and photosystem II efficiency?

Heteroplasmy Effects on CP47:
Since psbB is chloroplast-encoded, heteroplasmy in chloroplast genomes directly affects CP47 production and function. Studies in Arabidopsis have shown that heteroplasmic sorting (the fixation or loss of a variant) occurs rapidly in plastids, greatly exceeding rates observed in animals . This rapid sorting means that cells can quickly become homoplasmic for either wild-type or variant forms of genes like psbB.

Transmission and Segregation:
The bottleneck size during organellar genome transmission is a critical factor in heteroplasmy dynamics. Research indicates that this can be estimated using approaches such as:

  • Reciprocal normalized sample variance calculation

  • Maximum likelihood approaches based on the Kimura distribution

Experimental Considerations:
When studying variants of CP47, researchers should account for:

  • Segregation patterns across tissues and generations

  • Potential compensatory changes in other photosystem components

  • Tissue-specific differences in heteroplasmy levels

Understanding these dynamics is essential when interpreting phenotypic effects of CP47 variants, as heteroplasmy levels may vary between samples and affect experimental reproducibility.

Heteroplasmy AspectMeasurement ApproachSignificance for CP47 Research
Bottleneck SizeReciprocal normalized sample varianceIndicates transmission constraints
Segregation RateKimura distribution-based maximum likelihoodPredicts fixation timeline of variants
Tissue VarianceSample variance without Bessel's correctionShows tissue-specific selection pressures

What vector systems are recommended for expressing recombinant CP47 in plants?

Based on current research practices, several vector systems can be effectively employed for expressing recombinant CP47 in plants:

Binary Vector Systems:
For Agrobacterium-mediated transformation, binary vectors like those described in search result are commonly used. These typically contain:

  • Left and right border (LB and RB) sequences of T-DNA

  • Selection markers such as the BAR gene for herbicide (BASTA or glufosinate) resistance

  • A multicloning site (MCS) with multiple restriction sites for gene insertion

  • Strong constitutive promoters or tissue-specific promoters depending on research goals

An example of a suitable vector design from related research is the pCP vector, which contains:

  • A backbone fragment of 7,854 bp with RB and LB of the T-DNA

  • The BAR gene for herbicide resistance

  • A multicloning site of 141 bp including multiple restriction sites (EcoRI, ApaI, PstI, AvrII, EcoRV, BspEI, NcoI, and BglII)

Expression Cassette Design:
When designing expression cassettes for CP47, researchers should consider:

  • Including appropriate transit peptides for chloroplast targeting

  • Using promoters with suitable expression strength and tissue specificity

  • Incorporating epitope or affinity tags for purification and detection, positioned to minimize functional interference

Transformation Methods:
For introducing recombinant CP47 constructs into plants, several approaches are viable:

  • Stable transformation via Agrobacterium tumefaciens (as demonstrated with the GV3101 strain)

  • Transient transformation for rapid expression assessment

  • Biolistic transformation as an alternative for recalcitrant species

The choice of vector system should be guided by specific experimental objectives, the plant species being used, and the desired expression level and pattern.

What analytical techniques are most informative for characterizing recombinant CP47 structure and function?

A comprehensive characterization of recombinant CP47 requires multiple analytical approaches targeting different aspects of the protein:

Structural Analysis:

  • Circular dichroism spectroscopy for secondary structure assessment

  • Fourier-transform infrared spectroscopy (FTIR) for membrane protein structure

  • Limited proteolysis combined with mass spectrometry for domain architecture

  • Advanced structural techniques (X-ray crystallography, cryo-EM) for high-resolution structure

Functional Analysis:

  • Chlorophyll binding capacity and affinity measurements

  • Absorbance and fluorescence spectroscopy for pigment-protein interactions

  • Electron transfer kinetics in reconstituted systems

  • Oxygen evolution measurements in functional reconstitution experiments

Interaction Analysis:

  • Native gel electrophoresis for complex formation assessment

  • Blue native PAGE for intact complex visualization

  • Co-immunoprecipitation for identifying interaction partners

  • Chemical crosslinking coupled with mass spectrometry for interface mapping

Thermal and Chemical Stability:

  • Differential scanning calorimetry for thermal stability assessment

  • Chemical denaturation curves using intrinsic fluorescence

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

Each analytical approach provides complementary information, and combining multiple techniques yields the most comprehensive characterization of the recombinant protein.

How can CP47 be used as a tool for carotenoid engineering in plants?

While CP47 itself is primarily a chlorophyll-binding protein, research on photosynthetic proteins provides insights into how it could be used alongside carotenoid engineering approaches:

Integration with Carotenoid Pathways:
Research on Daucus carota has demonstrated successful genetic engineering approaches for carotenoid enhancement using genes like DcPSY2 and DcLCYB1 . CP47, as a major pigment-binding protein, functions within the same photosynthetic machinery affected by these carotenoid modifications.

Potential Applications:

  • Co-expression Strategies: CP47 could be co-engineered with carotenoid biosynthesis genes like DcPSY2 (phytoene synthase) and DcLCYB1 (lycopene β-cyclase) to create optimized photosynthetic complexes with enhanced carotenoid content .

  • Modified Binding Sites: Engineering CP47 binding pockets could potentially create variants capable of accommodating additional or modified carotenoids, enhancing light harvesting or photoprotection.

  • Biosensor Development: CP47 variants could be developed as biosensors for monitoring carotenoid production in engineered plants.

Experimental Approaches:
Research on carrot carotenoid engineering has employed techniques like:

  • Agrobacterium-mediated transformation with genes under control of constitutive promoters

  • Multiple gene cassettes in single vectors (similar to the pPSY2-CRTI-LCYB1 approach)

  • Testing in model systems before application in target crops

While not directly demonstrated in the search results, the integration of CP47 engineering with carotenoid pathway modification represents a promising direction for photosynthesis enhancement.

What are common challenges in expressing and purifying recombinant CP47, and how can they be addressed?

Researchers working with recombinant CP47 commonly encounter several challenges that require specific troubleshooting approaches:

Expression Challenges:

  • Low Expression Yields:

    • Optimize codon usage for the expression host

    • Test different promoters and expression conditions

    • Consider chloroplast transformation for plant-based expression

    • Evaluate different fusion tags to enhance stability

  • Improper Folding and Aggregation:

    • Express at lower temperatures (16-20°C) to slow folding

    • Co-express with chaperones to assist proper folding

    • Include stabilizing agents (glycerol, specific lipids) in growth media

    • Test expression in specialized membrane protein expression hosts

Purification Challenges:

  • Detergent Selection:

    • Test multiple detergents (DDM, digitonin, LMNG) to identify optimal solubilization

    • Consider detergent screening arrays to systematically evaluate options

    • Use fluorescence-detection size exclusion chromatography to assess protein monodispersity

  • Pigment Loss During Purification:

    • Work under green light to minimize photodamage

    • Include excess chlorophyll during purification steps

    • Minimize exposure to harsh conditions (extreme pH, high salt)

    • Use gentle elution conditions during chromatography

  • Protein Instability:

    • Determine optimal buffer conditions (pH, salt, additives) through stability screening

    • Consider amphipols or nanodiscs for long-term storage

    • Avoid freeze-thaw cycles by preparing single-use aliquots

    • Store at -80°C in the presence of cryoprotectants like glycerol

According to product information, the shelf life of recombinant proteins like CP47 is influenced by multiple factors including storage state, buffer ingredients, and storage temperature . Addressing these challenges requires systematic optimization of conditions at each experimental stage.

How can researchers verify that recombinant CP47 maintains its native structure and function?

Confirming that recombinant CP47 retains its native structure and function requires a multi-faceted validation approach:

Spectroscopic Validation:

  • Compare absorption spectra with native CP47 isolated from plant tissue

  • Analyze chlorophyll binding through fluorescence excitation/emission spectra

  • Use circular dichroism to compare secondary structure elements with native protein

Functional Assays:

  • Reconstitution with other PSII components to form partial or complete complexes

  • Energy transfer efficiency measurements between chlorophyll molecules

  • Binding assays with known interaction partners like PAM68

Structural Comparisons:

  • Limited proteolysis fingerprinting compared to native protein

  • Epitope accessibility using conformation-specific antibodies

  • Thermal stability profiles compared to the native protein

In vivo Complementation:

  • Express recombinant CP47 in mutant plants lacking functional psbB

  • Assess restoration of photosynthetic function

  • Measure photosystem II efficiency parameters (Fv/Fm, quantum yield)

Each validation method addresses different aspects of protein integrity, and concordance across multiple approaches provides strong evidence that the recombinant protein maintains native-like properties.

What emerging technologies could enhance our understanding of CP47 structure-function relationships?

Several cutting-edge technologies are poised to advance our understanding of CP47 and its role in photosynthesis:

Advanced Structural Biology:

  • Cryo-electron microscopy at near-atomic resolution to visualize CP47 within intact PSII

  • Integrative structural biology combining multiple data types (crosslinking, HDX-MS, etc.)

  • Time-resolved crystallography to capture different conformational states during function

Single-Molecule Techniques:

  • Single-molecule FRET to measure conformational dynamics

  • Atomic force microscopy for mechanical properties and interactions

  • Single-molecule force spectroscopy to probe domain stability

Advanced Spectroscopy:

  • Ultrafast transient absorption spectroscopy to track energy transfer pathways

  • Two-dimensional electronic spectroscopy for mapping pigment interactions

  • Raman spectroscopy for probing specific chemical bonds and interactions

Genetic and Genome Editing:

  • CRISPR-Cas9 precise editing of psbB to create specific variants

  • High-throughput mutagenesis coupled with phenotypic screening

  • Directed evolution approaches to identify optimized CP47 variants

Computational Methods:

  • Molecular dynamics simulations of CP47 within membrane environments

  • Quantum mechanical calculations of energy transfer processes

  • Machine learning approaches to predict structure-function relationships

These technologies, especially when used in combination, have the potential to reveal previously inaccessible details about how CP47 contributes to photosystem II function and efficiency.

How might studies of CP47 contribute to improving photosynthetic efficiency in crops?

Research on CP47 has significant potential to contribute to agricultural advances through several pathways:

Enhanced Photosynthetic Capacity:
Understanding the structure-function relationships in CP47 could enable engineering of variants with improved light-harvesting properties or more robust performance under stress conditions. This knowledge could be applied alongside other approaches like carotenoid engineering, which has already shown promise in increasing pigment content in fruits .

Stress Tolerance:
CP47 plays a critical role in photosystem II, which is particularly vulnerable to damage under environmental stresses. Engineering CP47 variants with enhanced stability could improve crop performance under adverse conditions such as:

  • High light intensity

  • Temperature extremes

  • Drought conditions

  • Salinity stress

Biofuel Applications:
Optimized photosynthesis through CP47 engineering could enhance biomass production for biofuel applications, contributing to renewable energy solutions.

The rapid segregation of plastid heteroplasmy observed in plants could be leveraged to quickly establish crop lines with engineered CP47 variants, accelerating the timeline from laboratory to field applications.

By combining insights from fundamental research on CP47 structure and function with advanced biotechnology approaches, researchers may develop novel strategies to address global challenges in food security and sustainable agriculture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.