Recombinant Daucus carota Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Expression System

  • Host: E. coli expression system ensures high yield and scalability .

  • Tag: N-terminal His tag facilitates affinity chromatography purification .

Stability and Handling

  • Degradation Risks: Susceptible to proteolysis, producing 24 kDa and 16 kDa fragments under suboptimal conditions .

  • Cross-Linking: May form complexes with cytochrome b559, altering electrophoretic mobility .

Mechanistic Studies of Photosystem II

  • Electron Transfer Dynamics: Used to study interactions with artificial electron acceptors (e.g., 2,5-dibromo-1,4-benzoquinone) at the Q<sub>B</sub> site .

  • D1 Protein Turnover: Critical for investigating PSII repair cycles under photoinhibitory conditions .

Comparative Analysis with Homologs

FeatureDaucus carota psbAProrocentrum micans psbA
Length (aa)344343
Sequence Identity100% (Carrot-specific)67% (vs. dinoflagellate)
Expression HostE. coliE. coli
UniProt IDQ0G9Y2Q9TM72
Data derived from .

Genomic and Evolutionary Context

  • Plastid Genome: The psbA gene is chloroplast-encoded in Daucus carota, located within the large single-copy (LSC) region of the 155.9 kb plastome .

  • Phylogenetic Conservation: Shares homology with PSII D1 proteins across plants, algae, and cyanobacteria, underscoring its role in oxygenic photosynthesis .

Challenges and Considerations

  • Storage Stability: Repeated freeze-thaw cycles degrade protein integrity; aliquot recommended .

  • Functional Assays: Requires reconstitution in lipid membranes to mimic native thylakoid conditions .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will then prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several downstream electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Daucus carota Photosystem Q(B) protein (psbA) and what is its role in photosynthesis?

The psbA gene encodes the D1 reaction center protein of photosystem II (PSII), which plays a crucial role in the initial stages of photosynthesis. In Daucus carota (wild carrot), as in other plants, the D1 protein is essential for photosynthetic electron transport and is particularly susceptible to light-induced damage. This protein is at the heart of a PSII repair cycle, where damaged D1 proteins are degraded and replaced with nascent ones to maintain photosynthetic function. Without this repair cycle, photosynthesis would be inhibited, compromising plant survival . The D1 protein functions within the thylakoid membrane of chloroplasts, where it coordinates cofactors essential for the water-splitting reaction and electron transfer processes of photosynthesis.

How does light affect psbA translation in Daucus carota?

Light stimulates the recruitment of ribosomes specifically to psbA mRNA in mature plant chloroplasts, including those of Daucus carota. This process provides nascent D1 protein for PSII repair. Additionally, light triggers a global increase in translation elongation rate. Recent research has revealed that the light-induced recruitment of ribosomes to psbA mRNA is specifically triggered by D1 photodamage, whereas the global stimulation of translation elongation is triggered by photosynthetic electron transport . This dual regulatory mechanism ensures that D1 protein synthesis is precisely coordinated with its rate of photodamage, maintaining optimal PSII function under varying light conditions.

What are the optimal storage conditions for recombinant Daucus carota psbA protein?

Recombinant Daucus carota psbA protein should be stored at -20°C to -80°C upon receipt, with aliquoting necessary for multiple uses to avoid repeated freeze-thaw cycles. For working aliquots, storage at 4°C is recommended for up to one week. The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose (pH 8.0) . For reconstitution, it is recommended to briefly centrifuge the vial before opening and to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being the standard) is advised for long-term storage .

What methodological approaches can be used to study light-dependent regulation of psbA translation?

Investigating light-dependent regulation of psbA translation requires multiple complementary approaches:

  • Ribosome profiling: This technique can be used to analyze ribosome occupancy on psbA mRNA under various light conditions. By isolating and sequencing ribosome-protected mRNA fragments, researchers can quantify translation efficiency and identify regulatory regions within the transcript .

  • Action spectrum analysis: By exposing plants to different wavelengths of light and measuring psbA translation rates, researchers can determine which photoreceptors or photosynthetic complexes are involved in signaling. Previous studies have indicated that the action spectrum for psbA translation matches that of D1 photodamage, suggesting a direct regulatory link .

  • Genetic approaches: Using mutants lacking specific components of the photosynthetic apparatus (such as HCF136, which mediates an early step in D1 assembly) can reveal regulatory mechanisms. Notably, hcf136 mutants exhibit constitutively high psbA ribosome occupancy even in the dark, differing from other PSII-deficient mutants .

  • In vitro translation systems: Chloroplast-specific translation systems can be developed using isolated chloroplasts or reconstructed translation machinery to study the direct effects of light and specific regulatory factors on psbA translation.

  • Pulse-chase labeling: This technique can be used to track the synthesis and turnover rates of D1 protein under different light conditions, providing insights into the dynamics of the PSII repair cycle.

What are the challenges in maintaining structural integrity of recombinant psbA protein during purification and experimental procedures?

The purification and maintenance of structural integrity of recombinant Daucus carota psbA protein presents several challenges:

ChallengeImpactMitigation Strategy
Membrane protein solubilityLow yield, aggregationUse appropriate detergents; optimize buffer conditions
Protein instabilityLoss of structural integrityInclude stabilizing agents (e.g., glycerol, trehalose)
Cofactor lossReduced functionalitySupplement with essential cofactors during purification
Oxidative damageStructural alterationsInclude reducing agents; perform procedures under nitrogen
His-tag interferenceAltered binding propertiesConsider tag removal; validate with tag-free protein

The D1 protein contains multiple transmembrane domains and interacts with numerous cofactors in its native environment. During recombinant expression and purification, these structural features can be disrupted, leading to protein aggregation or misfolding. When designing experiments, researchers should carefully consider these challenges and implement appropriate controls to ensure that the recombinant protein maintains its relevant structural and functional properties for the specific research question being addressed .

How can chloroplast transformation vectors be designed for efficient expression of modified psbA genes?

Designing chloroplast transformation vectors for efficient expression of modified psbA genes requires careful consideration of several factors:

  • Homologous recombination elements: The vector should include homologous flanking sequences (approximately 1 kb in size) on either side of the transgene cassette to facilitate double recombination into the chloroplast genome. These sequences should be homologous to the target site in the plastid genome and are essential for successful integration .

  • Promoter selection: The native psbA promoter or strong chloroplast promoters like the rrn promoter can drive high expression levels. The psbA promoter is particularly useful when light-regulated expression is desired.

  • Translation elements: Including the 5' untranslated region (UTR) of psbA can enhance translation efficiency, as it contains regulatory elements that respond to light and other stimuli.

  • Selection markers: Appropriate selection markers (such as aadA conferring spectinomycin resistance) are necessary to identify transformed plastids during the selection process.

  • Integration site: Careful selection of the integration site in the chloroplast genome is crucial to avoid disrupting essential genes while ensuring high expression levels.

The transformation process typically begins with DNA delivery into chloroplasts using biolistic methods, followed by integration of the transgene into a few genome copies. Subsequently, 25 to 30 cell divisions under selection pressure are required to eliminate untransformed plastids and achieve a homogeneous population of transformed plastid genomes . This process, known as homoplasmy, is essential for stable expression of the modified psbA gene.

What techniques can be used to analyze the function of recombinant Daucus carota psbA protein in photosystem II assembly and repair?

Several techniques can be employed to analyze the function of recombinant Daucus carota psbA protein in photosystem II assembly and repair:

  • Complementation studies: Introducing the recombinant psbA gene into psbA-deficient mutants to assess functional recovery of PSII activity.

  • Oxygen evolution measurements: Quantifying PSII function by measuring oxygen production rates under various light conditions.

  • Chlorophyll fluorescence analysis: Techniques such as pulse-amplitude modulation (PAM) fluorometry can assess PSII quantum yield, electron transport rates, and photoinhibition parameters.

  • Blue-native PAGE: This technique can separate intact protein complexes, allowing visualization of PSII assembly states and subcomplexes.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid assays, or bimolecular fluorescence complementation can identify proteins that interact with D1 during assembly and repair.

  • Thylakoid membrane fractionation: Isolating thylakoid membrane complexes can help identify the location and associations of newly synthesized D1 protein during the assembly process.

Recent research has identified a thylakoid membrane complex specifically involved in PSII assembly, PSII repair, and psbA translation . Studying the interactions between recombinant D1 protein and components of this complex can provide insights into the mechanisms governing PSII maintenance and repair.

How can researchers distinguish between native and recombinant psbA protein in experimental systems?

Distinguishing between native and recombinant psbA protein can be achieved through several complementary approaches:

  • Western blotting: Using antibodies specific to the His-tag present on the recombinant protein allows direct detection of the recombinant form. Additionally, antibodies against the D1 protein itself can detect both forms, with the recombinant version showing a slightly higher molecular weight due to the tag .

  • Mass spectrometry: Peptide mass fingerprinting or tandem mass spectrometry can identify unique peptides corresponding to either the native or recombinant protein, especially tag-containing peptides or those with modified residues.

  • Size exclusion chromatography: The slight size difference between native and recombinant proteins can sometimes be resolved using high-resolution size exclusion chromatography.

  • Metal affinity chromatography: The His-tagged recombinant protein will bind to metal affinity resins, while the native protein will not, allowing for separation of the two forms.

  • Functional assays with specific inhibitors: In some cases, the recombinant protein may show different sensitivity to specific inhibitors compared to the native form, which can be exploited for differentiation.

When conducting experiments in systems where both native and recombinant psbA proteins might be present, researchers should implement appropriate controls and verification steps to ensure that observed effects can be correctly attributed to the specific protein form under investigation.

How should researchers interpret differences in D1 protein turnover rates between in vitro and in vivo systems?

When interpreting differences in D1 protein turnover rates between in vitro and in vivo systems, researchers should consider several factors:

  • Physiological context: In vivo systems maintain the complete cellular environment, including the thylakoid membrane architecture, repair machinery, and regulatory networks that are not fully replicated in vitro. These differences can significantly affect D1 turnover rates and should be acknowledged in data interpretation.

  • Light conditions: The action spectrum for D1 photodamage in vivo is well-characterized, but in vitro systems may not respond to light in the same way. Differences in light quality, intensity, and duration between systems can lead to disparate turnover rates .

  • Ribosome availability: Light-induced recruitment of ribosomes to psbA mRNA is a key regulatory mechanism in vivo that may be absent or altered in vitro, affecting the rate of D1 replacement .

  • Repair complex integrity: Recent research has identified specialized thylakoid membrane complexes involved in PSII repair and psbA translation. The absence or modification of these complexes in vitro can significantly impact D1 turnover dynamics .

  • Post-translational modifications: The D1 protein undergoes various post-translational modifications in vivo that may be absent in recombinant systems, potentially affecting protein stability and turnover rates.

What statistical approaches are most appropriate for analyzing psbA expression data across different light conditions and genetic backgrounds?

When analyzing psbA expression data across different light conditions and genetic backgrounds, several statistical approaches are appropriate:

  • Two-way ANOVA: This approach is particularly useful for simultaneously evaluating the effects of two factors (e.g., light condition and genetic background) on psbA expression, as well as potential interaction effects between these factors.

  • Linear mixed-effects models: These models can account for repeated measurements over time or within experimental units, making them suitable for time-course experiments examining psbA expression under changing light conditions.

  • Principal Component Analysis (PCA): When analyzing multiple variables related to psbA expression and PSII function, PCA can help identify patterns and reduce dimensionality in complex datasets.

  • Regression analysis: For examining dose-response relationships between light intensity and psbA expression or translation rates, regression models can quantify the relationship and identify threshold effects.

  • Bootstrapping and permutation tests: These approaches are valuable when data do not meet the assumptions of parametric tests or when sample sizes are small, as is often the case in specialized mutant studies.

For studies comparing mutants lacking specific components (such as HCF136) with wild-type plants, careful consideration of appropriate controls is essential . Normalizing psbA expression data to appropriate reference genes or internal standards can help control for technical variability between samples and experiments.

How can researchers reconcile contradictory findings regarding psbA regulation in different plant species or experimental systems?

Reconciling contradictory findings regarding psbA regulation across different plant species or experimental systems requires a systematic approach:

  • Taxonomic considerations: Evolutionary differences between species, such as between Daucus carota and model organisms like Arabidopsis thaliana, can result in distinct regulatory mechanisms. Researchers should consider phylogenetic relationships when comparing results across species.

  • Methodological standardization: Differences in experimental protocols, including growth conditions, light sources, sample processing, and analytical techniques, can lead to apparently contradictory results. Standardizing methodologies or performing comparative studies using identical protocols can help resolve such discrepancies.

  • Environmental context: Variations in growth conditions, including temperature, photoperiod, and nutrient availability, can significantly influence psbA regulation. Meta-analyses that account for these variables can help identify consistent patterns across studies.

  • Temporal dynamics: The timing of measurements relative to light exposure or developmental stage can strongly impact results. Time-course experiments that capture the dynamic nature of psbA regulation can reconcile apparently contradictory findings from single time-point studies.

  • Integrated data analysis: Combining data from multiple approaches (e.g., transcriptomics, proteomics, and functional assays) can provide a more comprehensive understanding of psbA regulation and help resolve contradictions arising from single-method studies.

When comparing data between species like Daucus carota and model organisms, researchers should focus on conserved regulatory elements while acknowledging species-specific adaptations. Collaborative research efforts that implement standardized protocols across different plant species can significantly contribute to resolving contradictions in the literature regarding psbA regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.