Recombinant Debaryomyces hansenii 3-ketoacyl-CoA reductase (DEHA2G10780g)

Shipped with Ice Packs

In Stock

Cat. No.

BT2494897

Source

in vitro E.coli expression system

Synonyms

DEHA2G10780g; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase

Quick Inquiry

Description

Introduction to Recombinant Debaryomyces hansenii 3-Ketoacyl-CoA Reductase (DEHA2G10780g)

Recombinant Debaryomyces hansenii 3-ketoacyl-CoA reductase, encoded by the gene DEHA2G10780g, is an enzyme that plays a crucial role in fatty acid biosynthesis. This enzyme is involved in the reduction of 3-ketoacyl-CoA to form acyl-CoA, which is a key step in the elongation of fatty acid chains. The recombinant form of this enzyme is expressed in Escherichia coli and is available as a His-tagged protein, facilitating its purification and study .

Characteristics of Recombinant Debaryomyces hansenii 3-Ketoacyl-CoA Reductase

The recombinant Debaryomyces hansenii 3-ketoacyl-CoA reductase is a full-length protein consisting of 346 amino acids. It is fused with an N-terminal His tag to enhance its purification efficiency. The protein is supplied in a lyophilized form and has a purity of greater than 90% as determined by SDS-PAGE .

Function and Role in Fatty Acid Synthesis

3-Ketoacyl-CoA reductase is essential for the biosynthesis of fatty acids, particularly in the elongation process. It catalyzes the reduction of 3-ketoacyl-CoA to acyl-CoA, using NADPH as a cofactor. This step is crucial for the production of long-chain fatty acids, which are important components of cellular membranes and energy storage molecules .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time

Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.

Shelf Life

Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.

Tag Info

Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its use.

Synonyms

DEHA2G10780g; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-346

Protein Length

full length protein

Species

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Target Names

DEHA2G10780g

Target Protein Sequence

MSLCQFVSSISDCRITQALIYGVLFVGVYKITTFTLSVGSLLVDLFVLPAVDFKKYGAKQ GKWAVVTGASDGIGKEYAYQLASRGLNVVLISRTLSKLELIATEIETKYKVSTEVIAFDA STDNDANYAKILHTVSNLPVTVLVNNVGQSHSIPVPFLETEDKELRDIITINNTVTLKIT QAVAPVIADTVAKENKKVKGLILTMGSFGGLLPTPYLATYSGSKSFLQAWSSALAGELKP QGIDVQLVISYLVTSAMSKIRRSSASIPNPKNFVTSVLNTAGRRCGAQERFATTTPYWTH ALMHFGIENTVGVYSKFANSLNFSMHKSIRVRALKKAARANATKTD

Uniprot No.

Q6BIG0

Target Background

Function

Recombinant Debaryomyces hansenii 3-ketoacyl-CoA reductase (DEHA2G10780g) is a microsomal membrane-bound enzyme integral to the fatty acid elongation system. It catalyzes the production of 26-carbon very-long-chain fatty acids (VLCFAs) from palmitate by reducing the 3-ketoacyl-CoA intermediate in each elongation cycle. These VLCFAs serve as precursors for ceramide and sphingolipid biosynthesis.

Database Links

KEGG: dha:DEHA2G10780g

Protein Families

Short-chain dehydrogenases/reductases (SDR) family

Subcellular Location

Endoplasmic reticulum membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Debaryomyces hansenii 3-ketoacyl-CoA reductase (DEHA2G10780g)

Description

Introduction to Recombinant Debaryomyces hansenii 3-Ketoacyl-CoA Reductase (DEHA2G10780g)

Characteristics of Recombinant Debaryomyces hansenii 3-Ketoacyl-CoA Reductase

Function and Role in Fatty Acid Synthesis

Product Specs

Target Background

Quick Inquiry

Category

Service