Recombinant Debaryomyces hansenii 3-ketodihydrosphingosine reductase TSC10 (TSC10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TSC10; DEHA2E04576g; 3-ketodihydrosphingosine reductase TSC10; 3-dehydrosphinganine reductase; KDS reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
TSC10
Target Protein Sequence
MLFSNNKIHAEGKLALIVGASQGLGADLALKLYQQNCSVILVARTETKLVAQIERIQSSS PENNATLSYKCCDASNYEDCVKLWNDLIVDQKQDPDFIFCCAGSSIPKLFSDLTAKDFAI GINTNYTTSLNITHTGFKQVLGQFSDLSCDQYKKRHVIFVSSVVSFYPFIGYSQYAPLKS AIQSLSIILRQEMGPFNYRVSCVFPGNFQSEGYEEEQKTKPSITKSIEGSSKPISGEDCA DIILNQLNRGYDTVTTDFIGWLLGCSVLGVLPRSWGFFQVIVSFIFSIIAPIANYVVYRD VLKFFKTRSTREVEEYEIVSTDDNKKTL
Uniprot No.

Target Background

Function
Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is 3-ketodihydrosphingosine reductase TSC10 and what is its function in sphingolipid metabolism?

3-Ketodihydrosphingosine reductase TSC10 is an essential enzyme that catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS) in the de novo sphingolipid biosynthesis pathway . This reaction represents the second step in sphingolipid biosynthesis, following the condensation of L-serine and palmitoyl-CoA by serine palmitoyltransferase (SPT) . The enzyme belongs to the short-chain dehydrogenase/reductase (SDR) superfamily and is critical for maintaining cellular sphingolipid homeostasis .

In yeast, the TSC10 gene is essential, and its deletion disrupts normal sphingolipid metabolism . The enzyme functions within the endoplasmic reticulum (ER), coordinating with other enzymes in the sphingolipid biosynthetic pathway to maintain proper cellular function .

What are the structural characteristics of TSC10 from Debaryomyces hansenii?

TSC10 from Debaryomyces hansenii is a protein of approximately 328 amino acids with a molecular weight of approximately 36.5 kDa . While the specific crystal structure of D. hansenii TSC10 has not been published, the structure of TSC10 from Cryptococcus neoformans has been determined, providing valuable insights applicable to other fungal TSC10 proteins .

The enzyme adopts a Rossmann fold characteristic of short-chain dehydrogenase/reductase (SDR) family members, consisting of a central seven-stranded β-sheet flanked by α-helices on both sides . The protein contains NADPH-binding domains and a catalytic triad that is conserved among SDR enzymes . Several regions of the protein demonstrate significant flexibility, including the segment connecting the serine and tyrosine residues of the catalytic triad, the "substrate loop," and the C-terminal region .

Notably, cnTSC10 (from C. neoformans) is predominantly dimeric in solution, with a small portion forming homo-tetramers . The homo-dimer interface involves both hydrophobic and hydrophilic interactions mediated by helices α4 and α5, as well as the loop connecting strand β4 and helix α4 .

How is recombinant Debaryomyces hansenii TSC10 protein typically expressed and purified?

Recombinant Debaryomyces hansenii TSC10 is typically expressed in heterologous systems such as E. coli . The expression construct generally includes a His-tag at the N-terminus to facilitate purification . The full-length protein (amino acids 1-328) is commonly used for recombinant expression .

A typical expression and purification protocol includes:

  • Cloning the full-length coding sequence into an appropriate expression vector

  • Transformation into an E. coli expression strain

  • Induction of protein expression (typically with IPTG for T7-based systems)

  • Cell lysis under native conditions

  • Purification using nickel or cobalt affinity chromatography

  • Further purification steps such as size exclusion chromatography if needed

  • Quality control by SDS-PAGE to ensure >85-90% purity

The purified protein is typically stored in a Tris-based buffer containing glycerol (often 6-50%) at pH 8.0 . For long-term storage, the protein can be stored at -20°C or -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles .

How can enzyme kinetics of TSC10 be accurately measured and analyzed?

Accurately measuring TSC10 enzyme kinetics requires specialized techniques due to the lipophilic nature of its substrate and product. Several methodological approaches have been developed:

HPLC-ESI-MS/MS Method:

A high-performance liquid chromatography coupled with electrospray ionization tandem mass spectrometry (HPLC-ESI-MS/MS) approach offers direct quantification of 3KDS generated and converted by the enzyme . This method eliminates the need for radioactive reagents and derivatization steps:

  • Prepare microsomes containing TSC10 or purified recombinant TSC10

  • Set up reaction mixtures containing the enzyme, NADPH, and substrate (3KDS)

  • Incubate under appropriate conditions (typically 37°C for mammalian enzymes or 30°C for yeast enzymes)

  • Extract lipids using chloroform/methanol (2:1)

  • Analyze using HPLC-ESI-MS/MS with appropriate internal standards (e.g., C17-sphinganine)

  • Quantify substrate consumption and product formation

For kinetic parameter determination:

  • Vary substrate concentration while keeping enzyme concentration constant

  • Plot reaction velocity versus substrate concentration

  • Fit data to appropriate kinetic models (Michaelis-Menten, Hill equation for cooperative binding, etc.)

  • Calculate Km, Vmax, and catalytic efficiency (kcat/Km)

This approach has revealed important insights into yeast SPT activity, including possible multiple palmitoyl-CoA binding sites and positive cooperativity between them .

Contradictions in experimental data can arise from various sources when working with TSC10. A structured approach to resolving these contradictions includes:

Step 1: Identify the type of contradiction

Use a systematic classification based on three parameters (α, β, θ):

  • α: number of interdependent items

  • β: number of contradictory dependencies

  • θ: minimal number of required Boolean rules to assess contradictions

For example, a (2,1,1) class contradiction would involve two interdependent data items with one contradictory dependency that can be assessed using one Boolean rule .

Step 2: Analyze potential sources of contradiction

Common sources of experimental contradictions when working with TSC10 include:

  • Protein preparation differences: Variations in expression systems, purification methods, and protein tags can affect enzyme activity

  • Assay conditions: Temperature, pH, buffer composition, and presence of detergents can significantly impact enzyme kinetics

  • Substrate preparation: The physical state of lipophilic substrates (micelles, liposomes, protein-bound) affects enzyme accessibility

  • Detection methods: Different sensitivities and specificities of analytical techniques

Step 3: Design critical experiments to resolve contradictions

  • Use multiple orthogonal techniques to measure the same parameter

  • Systematically vary key conditions to identify dependencies

  • Employ internal controls for normalization

  • Consider using isotope labeling to track metabolic flux

Step 4: Apply structured contradiction analysis

Researchers can employ Boolean minimization techniques to handle complex contradiction patterns and reduce the number of required rules for assessment . This approach helps manage multidimensional interdependencies within datasets and provides a framework for resolving apparent contradictions .

What role does TSC10 play in endoplasmic reticulum (ER) homeostasis and stress response?

Studies of the mammalian homolog KDSR provide insights into the critical role of 3-ketodihydrosphingosine reductase in maintaining ER homeostasis:

ER Structure and Function:

Loss of KDSR in leukemia cells leads to aberrant ER structure, suggesting a structural role for the enzyme or its products in maintaining ER morphology . This observation indicates that proper sphingolipid metabolism is essential for ER membrane integrity.

Unfolded Protein Response (UPR):

KDSR is indispensable for maintaining the unfolded protein response (UPR) in the ER . Depletion of KDSR results in dysregulated UPR checkpoint proteins PERK, ATF6, and ATF4, key regulators of ER stress responses .

Molecular Mechanism:

The accumulation of 3-ketodihydrosphingosine (KDS) following KDSR depletion suggests that either:

  • The substrate KDS itself is toxic when accumulated

  • The absence of the product dihydrosphingosine (DHS) disrupts downstream sphingolipid synthesis

  • A combination of both factors contributes to ER stress

Transcriptomic analysis has revealed significant alterations in gene expression patterns following KDSR loss, particularly affecting pathways involved in protein folding and ER stress response .

Therapeutic Implications:

The synergism observed between KDSR suppression and pharmacologically induced ER-stress suggests a potential therapeutic approach for diseases like leukemia, targeting both sphingolipid metabolism and ER homeostasis simultaneously .

What methodological approaches can be used to study TSC10 topology and membrane integration?

Understanding the membrane topology and integration of TSC10 is crucial for elucidating its function within the ER. Several complementary approaches can be employed:

Topology Reporter Fusion Constructs:

Glycosylation cassette (GC) insertions at various positions within the TSC10 sequence can be used to map the topology :

  • Create fusion constructs with invertase glycosylation cassettes inserted at different positions

  • Express constructs in appropriate cells

  • Analyze glycosylation status using endoglycosidase H (EndoH) treatment

  • Glycosylated domains are interpreted as facing the ER lumen, while non-glycosylated domains are cytosolic

Fluorescence Microscopy with GFP Fusions:

  • Create GFP fusion constructs with different domains of TSC10 (N-terminal, C-terminal, or internal fusions)

  • Express in cells and examine localization by fluorescence microscopy

  • Co-localize with ER markers to confirm proper targeting

  • Use truncation and deletion mutants to identify targeting signals

Immunoprecipitation and Protein Interaction Studies:

  • Create epitope-tagged versions of TSC10 (HA, MYC tags)

  • Perform immunoprecipitation to isolate protein complexes

  • Analyze interacting partners by mass spectrometry

  • Use crosslinking approaches to capture transient interactions

Protease Protection Assays:

  • Prepare microsomes containing TSC10

  • Treat with proteases in the presence or absence of detergents

  • Analyze protease-resistant fragments by immunoblotting

  • Domains protected from proteolysis in the absence of detergents are likely within the membrane or facing the lumen

These approaches have revealed that yeast Tsc10p contains a dilysine motif in its C-terminal region for ER retention and two predicted transmembrane domains in the C-terminal end, whereas mammalian FVT1 has no C-terminal dilysine motif but contains an N-terminal extension with a predicted transmembrane domain .

How can researchers express and purify functionally active recombinant TSC10 for enzymatic assays?

Producing functionally active recombinant TSC10 requires careful attention to protein folding and cofactor binding. A detailed protocol includes:

Expression Vector Design:

  • Include the full coding sequence (1-328 amino acids) of Debaryomyces hansenii TSC10

  • Add an N-terminal His-tag for purification

  • Use a vector with an inducible promoter (e.g., T7 for E. coli expression)

  • Consider including a TEV protease cleavage site if tag removal is desired

Optimal Expression Conditions:

  • Transform expression vector into E. coli BL21(DE3) or Rosetta strains

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce with IPTG at a reduced temperature (16-20°C) overnight to enhance proper folding

  • Supplement growth medium with zinc or other divalent metal ions if required for enzyme activity

Purification Strategy:

  • Harvest cells and lyse in buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM PMSF, and 5% glycerol

  • Include 1 mM β-mercaptoethanol or DTT to maintain reducing conditions

  • Purify using nickel affinity chromatography with imidazole gradient elution

  • Perform size exclusion chromatography to ensure monomeric/dimeric state

  • Concentrate protein and exchange into storage buffer (Tris/PBS-based buffer with 6-50% trehalose or glycerol at pH 8.0)

Activity Preservation:

  • Add NADPH (0.1-0.5 mM) during purification to stabilize enzyme conformation

  • Avoid freeze-thaw cycles by storing working aliquots at 4°C for up to one week

  • For long-term storage, flash-freeze in liquid nitrogen and store at -80°C

  • Confirm enzyme activity using HPLC-ESI-MS/MS assay before experimental use

What are effective strategies for studying TSC10 catalytic mechanisms through site-directed mutagenesis?

Site-directed mutagenesis provides valuable insights into TSC10 catalytic mechanisms. Based on structural data and sequence homology with other SDR family enzymes, key residues can be targeted:

Identification of Catalytic Residues:

  • Catalytic Triad: Identify conserved Ser-Tyr-Lys residues that form the catalytic triad in SDR enzymes

  • NADPH Binding Site: Target residues in the Rossmann fold that interact with the NADPH cofactor

  • Substrate Binding Pocket: Identify hydrophobic residues likely involved in substrate binding

  • Dimer Interface: Target residues involved in dimerization

Mutagenesis Protocol:

  • Generate mutations using QuikChange site-directed mutagenesis (QCM) or other PCR-based methods

  • Create conservative mutations (e.g., Ser→Ala, Tyr→Phe) to minimize structural disruption

  • Express and purify mutant proteins alongside wild-type controls

  • Analyze protein folding and stability using circular dichroism or thermal shift assays

Functional Analysis of Mutants:

  • Measure enzyme kinetics (Km, kcat, kcat/Km) using HPLC-ESI-MS/MS

  • Determine cofactor binding affinity through isothermal titration calorimetry

  • Assess structural changes using limited proteolysis or hydrogen-deuterium exchange

  • Test substrate specificity with different chain-length KDS analogs

Data Interpretation:

Mutations in the catalytic triad typically abolish or severely reduce activity, while mutations in substrate binding regions may alter substrate specificity or binding affinity without eliminating activity. Mutations at the dimer interface may affect oligomeric state and indirectly impact catalytic efficiency .

How can TSC10 from Debaryomyces hansenii be utilized in probiotic research?

The discovery that Debaryomyces hansenii strains possess potential probiotic properties opens interesting research avenues for utilizing TSC10 in this context:

TSC10 Role in Probiotic Properties:

  • Investigate whether TSC10-mediated sphingolipid metabolism contributes to D. hansenii's ability to survive gastrointestinal conditions

  • Determine if sphingolipids produced via the TSC10 pathway influence adhesion to intestinal epithelial cells

  • Explore potential immunomodulatory effects of TSC10-dependent sphingolipids on dendritic cells

Experimental Approaches:

  • TSC10 Knockout Studies:

    • Generate TSC10 knockout strains using CRISPR/Cas9

    • Compare survivability under gastrointestinal stress conditions

    • Assess adhesion properties to Caco-2 cells and mucin

    • Measure immunomodulatory effects on human monocyte-derived dendritic cells

  • Sphingolipid Profiling:

    • Compare sphingolipid profiles of wild-type and TSC10-modified D. hansenii strains

    • Correlate specific sphingolipid species with probiotic properties

    • Identify bioactive sphingolipid molecules that might contribute to health benefits

  • In Vivo Testing:

    • Administer wild-type and TSC10-modified D. hansenii to mice (e.g., 1×10^8 CFU daily)

    • Assess gut colonization and persistence

    • Measure immune parameters including phagocytosis, respiratory burst activity, and cytokine expression

    • Compare serum IgG and IgA titers

Current research has shown that D. hansenii strains can enhance immunological parameters in mice, modulate pro-inflammatory cytokine gene expression, and colonize the intestine . Understanding TSC10's role in these processes could lead to engineered probiotic strains with enhanced beneficial properties.

What potential therapeutic applications exist for targeting TSC10 or its mammalian homolog KDSR?

Based on recent findings, several promising therapeutic applications are emerging:

Cancer Therapy:

KDSR has been identified as essential for leukemia cell maintenance, with its loss leading to apoptosis, cell cycle arrest, and aberrant ER structure . Targeting KDSR in combination with ER stress-inducing agents shows synergistic effects, presenting a novel therapeutic strategy for leukemia treatment .

Antifungal Development:

The structural differences between fungal TSC10 and mammalian KDSR, particularly in the dimer interface, offer opportunities for selective inhibitor design . Compounds targeting fungal-specific aspects of TSC10 structure or regulation could lead to new antifungal agents with reduced host toxicity .

Dermatological Applications:

Mutations in human KDSR are associated with progressive symmetric erythrokeratoderma and other skin disorders. Understanding TSC10/KDSR function could lead to new treatments for these conditions through sphingolipid modulation .

Inflammatory Disease Management:

Given the role of sphingolipids in immune regulation and the observation that some D. hansenii strains elicit a higher IL-10/IL-12 ratio than probiotic S. boulardii strains, TSC10-mediated sphingolipid production might be targeted to develop anti-inflammatory therapies .

How can advanced structural biology techniques contribute to understanding TSC10 function?

Advanced structural biology techniques offer tremendous potential for deepening our understanding of TSC10:

Cryo-Electron Microscopy (Cryo-EM):

  • Determine the structure of full-length TSC10 including transmembrane domains

  • Visualize TSC10 within native membrane environments

  • Capture different conformational states during the catalytic cycle

  • Resolve oligomeric arrangements in membrane contexts

Molecular Dynamics Simulations:

  • Model substrate binding and catalytic mechanisms

  • Simulate conformational changes during catalysis

  • Investigate water networks and proton transfer pathways

  • Predict effects of mutations on protein dynamics and function

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Map protein dynamics and conformational changes

  • Identify regions with altered solvent accessibility upon substrate binding

  • Detect subtle structural effects of mutations

  • Analyze protein-protein interaction interfaces

Integrative Structural Biology Approaches:

Combining multiple techniques (X-ray crystallography, NMR, SAXS, crosslinking-MS) could provide comprehensive structural insights that no single method can achieve alone .

These advanced techniques would help resolve important questions such as how TSC10 recognizes its substrate, how conformational changes coordinate catalysis, and how the enzyme interacts with other components of the sphingolipid biosynthetic machinery.

What approaches can be used to resolve contradictions in TSC10 topology models?

Contradictions in TSC10 topology models can be addressed through a multi-faceted approach:

Systematic Topology Mapping:

  • Insert reporter tags (glycosylation sites, TEV protease sites, etc.) at multiple positions throughout TSC10

  • Develop a comprehensive topology map with high resolution

  • Use multiple orthogonal reporters to cross-validate findings

  • Test topology under different conditions (e.g., with or without specific lipids)

Comparison of Orthologous Proteins:

  • Analyze topology of TSC10 from multiple fungal species

  • Compare with mammalian KDSR topology

  • Identify conserved topological features versus species-specific adaptations

  • Correlate topology differences with functional divergence

Structural Approaches:

  • Determine structures of both fungal TSC10 and mammalian KDSR

  • Use molecular dynamics to simulate membrane integration

  • Apply electron microscopy to visualize the protein in membrane environments

  • Use antibodies against specific epitopes to probe accessibility in native membranes

Resolution Framework for Contradictions:

Apply a structured approach to analyze contradictions in topology data:

  • Classify contradiction types (self-contradictory data, contradicting data pairs, conditional contradictions)

  • Apply Boolean minimization techniques to reduce complexity

  • Design critical experiments to directly address specific contradictions

  • Develop a unified model that accommodates all reliable data points

Current research indicates that fungal Tsc10p contains C-terminal transmembrane domains while mammalian FVT1 has an N-terminal transmembrane domain . Resolving contradictions in these models will enhance our understanding of how these enzymes function within the ER membrane environment.

What are the best methods for measuring TSC10 activity in different experimental systems?

Measuring TSC10 activity requires consideration of the specific experimental system and research questions. Several methodological approaches can be employed:

In Vitro Assays with Purified Enzyme:

  • HPLC-ESI-MS/MS Assay:

    • Incubate purified TSC10 with 3KDS substrate and NADPH

    • Extract lipids and analyze by HPLC-ESI-MS/MS

    • Quantify conversion of 3KDS to DHS using appropriate internal standards

    • Calculate enzyme activity (nmol product/min/mg protein)

  • Spectrophotometric NADPH Consumption Assay:

    • Monitor NADPH oxidation at 340 nm

    • Calculate activity based on NADPH consumption rate

    • Confirm product formation to ensure NADPH oxidation corresponds to 3KDS reduction

Cellular Systems:

  • Microsomal Assays:

    • Prepare microsomes from cells expressing TSC10

    • Incubate with 3KDS and NADPH

    • Extract lipids and analyze by HPLC-ESI-MS/MS

    • Account for background activity from endogenous enzymes

  • Metabolic Labeling:

    • Incubate cells with isotope-labeled serine or palmitoyl-CoA

    • Extract and analyze labeled sphingolipids

    • Measure flux through the sphingolipid pathway

    • Compare wild-type with TSC10-overexpressing or depleted cells

In Vivo Systems:

  • Sphingolipid Profiling in Model Organisms:

    • Generate TSC10 mutants or knockout models

    • Extract and analyze sphingolipids from tissues or whole organisms

    • Quantify changes in 3KDS, DHS, and downstream metabolites

    • Correlate sphingolipid alterations with phenotypic changes

  • Complementation Assays:

    • Use yeast TSC10 deletion mutants complemented with D. hansenii TSC10

    • Measure restoration of growth and sphingolipid synthesis

    • Compare activity of wild-type and mutant TSC10 variants

The HPLC-ESI-MS/MS approach offers several advantages, including direct measurement of substrate and product without derivatization, elimination of radioactive materials, high sensitivity, and ability to detect multiple sphingolipid species simultaneously .

How can researchers effectively manage data contradictions when studying TSC10 enzyme kinetics?

Enzyme kinetic studies of TSC10 can yield contradictory results due to various factors including substrate presentation, assay conditions, and detection methods. A structured approach to managing these contradictions includes:

Standardized Experimental Protocols:

  • Establish rigorous protocols for enzyme preparation, substrate preparation, and assay conditions

  • Document all experimental variables comprehensively

  • Use consistent buffer compositions, temperature, and pH

  • Standardize methods for substrate preparation (micelles, liposomes, protein carriers)

Multiple Detection Methods:

  • Apply orthogonal techniques to measure enzyme activity

  • Compare direct product formation (HPLC-MS/MS) with cofactor consumption (spectrophotometric)

  • Use isotope labeling to track metabolic flux

  • Validate key findings with multiple independent methods

Structured Contradiction Analysis:

Apply a formal framework for analyzing contradictions in enzyme kinetic data:

  • Identify interdependent experimental variables (α)

  • Determine the number of contradictory dependencies (β)

  • Establish the minimum number of Boolean rules needed to resolve contradictions (θ)

  • Design targeted experiments to directly address specific contradictions

Statistical Approaches:

  • Apply robust statistical methods for outlier detection

  • Use Bayesian approaches to integrate prior knowledge with new data

  • Develop mathematical models that can accommodate experimental variability

  • Conduct sensitivity analyses to identify key parameters affecting outcomes

By systematically addressing potential sources of contradiction and applying structured analysis frameworks, researchers can develop more reliable and reproducible methods for characterizing TSC10 enzyme kinetics.

What cutting-edge analytical techniques are emerging for studying TSC10 and sphingolipid metabolism?

Several cutting-edge analytical techniques are transforming research on TSC10 and sphingolipid metabolism:

Advanced Mass Spectrometry:

  • Ion Mobility-Mass Spectrometry (IM-MS):

    • Separates isomeric sphingolipids based on molecular shape

    • Provides structural information beyond mass alone

    • Enhances identification of novel sphingolipid species

    • Enables kinetic studies with improved specificity

  • MALDI-Imaging Mass Spectrometry:

    • Maps sphingolipid distribution in tissues with spatial resolution

    • Correlates TSC10 activity with local sphingolipid profiles

    • Visualizes metabolic pathways in cellular contexts

    • Monitors therapeutic interventions targeting sphingolipid metabolism

Single-Cell Technologies:

  • Single-Cell Metabolomics:

    • Measures sphingolipid levels in individual cells

    • Reveals cell-to-cell variability in TSC10 activity

    • Identifies subpopulations with distinct metabolic states

    • Correlates sphingolipid profiles with cell phenotypes

  • Multi-omics Integration:

    • Combines metabolomics, proteomics, and transcriptomics

    • Provides systems-level view of TSC10 function

    • Identifies regulatory networks controlling sphingolipid metabolism

    • Reveals unexpected connections between pathways

Real-time Monitoring:

  • FRET-based Biosensors:

    • Develop sensors for sphingolipid metabolites

    • Monitor enzyme activity in living cells

    • Track sphingolipid dynamics with temporal resolution

    • Visualize compartment-specific changes in metabolism

  • Click Chemistry Approaches:

    • Use bioorthogonal reactions to label sphingolipids

    • Track newly synthesized molecules in real-time

    • Study trafficking and turnover of sphingolipids

    • Determine half-lives of different sphingolipid species

These emerging techniques promise to revolutionize our understanding of TSC10 function and sphingolipid metabolism by providing unprecedented spatial, temporal, and molecular resolution for studying these complex biological processes.

What are the most promising future directions for TSC10 research?

Based on current knowledge and emerging technologies, several research directions show particular promise:

  • Structural Biology: Determining high-resolution structures of full-length TSC10 in membrane environments would provide crucial insights into its catalytic mechanism and regulation .

  • Therapeutic Applications: Exploring TSC10/KDSR as a target for antifungal, anticancer, and immunomodulatory therapeutics represents a high-impact research direction .

  • Systems Biology: Investigating TSC10's role within the broader sphingolipid metabolic network and its connections to other cellular pathways would provide a more comprehensive understanding of its biological significance .

  • Comparative Studies: Detailed comparisons between fungal TSC10 and mammalian KDSR could reveal evolutionary adaptations and species-specific functions that might be exploited therapeutically .

  • Probiotic Applications: Further research into D. hansenii as a probiotic organism, with particular focus on TSC10's contribution to beneficial properties, could lead to novel health-promoting applications .

By pursuing these research directions with rigorous methodologies and advanced analytical techniques, researchers can significantly advance our understanding of TSC10 biology and its applications in medicine and biotechnology.

What methodological recommendations can improve reproducibility in TSC10 research?

To enhance reproducibility in TSC10 research, consider the following methodological recommendations:

  • Standardized Protein Production:

    • Adopt consistent expression systems and purification protocols

    • Report detailed buffer compositions and storage conditions

    • Document protein yield, purity, and specific activity

    • Share expression constructs through repositories

  • Enzyme Activity Assays:

    • Establish standardized assay conditions (temperature, pH, ionic strength)

    • Use multiple detection methods to confirm activity measurements

    • Include appropriate controls for background activity

    • Report detailed substrate preparation methods

  • Data Reporting Standards:

    • Provide complete experimental details in publications

    • Share raw data through appropriate repositories

    • Report all tested conditions, including negative results

    • Use appropriate statistical methods and report all parameters

  • Contradiction Management:

    • Implement systematic approaches to identify and resolve contradictions

    • Classify contradiction types using standardized notation (α, β, θ)

    • Develop minimal sets of Boolean rules to assess contradictions

    • Document all assumptions and limitations in data interpretation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.