Recombinant Debaryomyces hansenii Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Debaryomyces hansenii Altered Inheritance of Mitochondria Protein 11 (AIM11)

Debaryomyces hansenii Altered Inheritance of Mitochondria protein 11 (AIM11) is a protein associated with mitochondrial function in the yeast Debaryomyces hansenii . AIM11 is involved in the inheritance and maintenance of mitochondria, which are essential organelles responsible for energy production within cells . Recombinant AIM11 refers to the protein produced using recombinant DNA technology, where the gene encoding AIM11 is expressed in a host organism such as E. coli .

Gene Information

The gene name for Altered Inheritance of Mitochondria protein 11 in Debaryomyces hansenii is AIM11. Synonyms for this gene include AIM11 and DEHA2A08514g . The UniProt ID for AIM11 is Q6BYM1 .

Protein Characteristics

Recombinant AIM11 is a full-length protein consisting of 166 amino acids . The protein is fused to an N-terminal His tag to facilitate purification . The amino acid sequence of the recombinant AIM11 protein is: MSAEPSQFNKLLTKYDFKLASASEEYRNRRKRQMMLFMGSAAITIFTSRLAYKSTITRQY VPSLFQGNHAPPLSYNFTSDAAVAVGTGTLLCGSVSSMVIFGTCWIIDVSNFQEFGWKMK SLMGGYEKQKELAKLPMDEESAFLQDSLNDILDGKYDFDETTPAEK .

Production and Purification

Recombinant AIM11 protein is expressed in E. coli . After expression, the protein is purified, and its purity is determined by SDS-PAGE, with a purity level greater than 90% .

Function and Significance

AIM11 is crucial for maintaining mitochondrial function and inheritance . Mitochondria are essential organelles responsible for energy production, and their proper distribution is vital for cell survival .

Applications in Biotechnology

Debaryomyces hansenii is a halotolerant yeast with the ability to grow in high-salt environments, making it suitable for various biotechnological applications . It can metabolize a variety of sugars and tolerate extreme temperatures and pH levels . D. hansenii can produce recombinant proteins in complex feedstocks, such as industrial waste . The ability of D. hansenii to grow and produce recombinant proteins in salt-rich by-products from the dairy industry has been demonstrated, offering a biological alternative to revalue dairy by-products and reduce environmental impact . Open (non-sterile) cultivations of D. hansenii for recombinant protein production have been achieved by combining industrial side-streams with high salt concentrations .

Tables

Table 1: Recombinant AIM11 Protein Information

CategoryDescription
Gene NameAIM11
SynonymsAIM11; DEHA2A08514g; Altered inheritance of mitochondria protein 11
UniProt IDQ6BYM1
SourceE. coli
TagHis
Protein LengthFull Length (1-166 aa)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AIM11; DEHA2A08514g; Altered inheritance of mitochondria protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
AIM11
Target Protein Sequence
MSAEPSQFNKLLTKYDFKLASASEEYRNRRKRQMMLFMGSAAITIFTSRLAYKSTITRQY VPSLFQGNHAPPLSYNFTSDAAVAVGTGTLLCGSVSSMVIFGTCWIIDVSNFQEFGWKMK SLMGGYEKQKELAKLPMDEESAFLQDSLNDILDGKYDFDETTPAEK
Uniprot No.

Target Background

Database Links
Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii and why is it significant for mitochondrial research?

Debaryomyces hansenii is a non-conventional yeast species with remarkable characteristics that make it particularly valuable for biotechnological applications. This organism possesses intrinsic beneficial traits including halotolerance (ability to thrive in high salt concentrations), utilization of diverse carbon sources, and resistance to extreme temperatures and pH levels. These properties enable D. hansenii to grow in unconventional feedstock such as industrial by-products, making it an excellent candidate for sustainable bioprocessing applications .

D. hansenii is commonly found in cheeses and has gained attention in the research community for its unique physiological properties. Beyond its applications in biotechnology, D. hansenii is increasingly studied for its potential in understanding fundamental biological processes, including mitochondrial inheritance patterns . Its robustness and genetic tractability make it particularly valuable for studying complex cellular mechanisms.

What is mitochondrial inheritance and why is maternal inheritance predominant?

Mitochondrial inheritance refers to the transmission of mitochondria and their associated mitochondrial DNA (mtDNA) from parent to offspring. In most animal species, including humans, mitochondria are almost exclusively inherited from the maternal lineage, resulting in offspring possessing a single haplotype of mtDNA derived from their mother .

This pattern of uniparental inheritance is maintained through a conserved process known as post-fertilization sperm mitophagy, wherein paternal mitochondria are systematically degraded after fertilization. This degradation involves multiple molecular mechanisms, primarily the ubiquitin-proteasome system and autophagy pathways. Ubiquitin-binding pro-autophagic receptors such as SQSTM1 and GABARAP have been demonstrated to contribute to sperm mitophagy in mammals .

The evolutionary conservation of maternal inheritance suggests significant biological importance. Research has shown that heteroplasmy (the presence of two distinct populations of mtDNA haplotypes) can lead to detrimental effects. Laboratory studies in mice and nematodes have demonstrated that heteroplasmic organisms often exhibit reduced physiological function, including decreased metabolic rates, reduced fertility, and even increased embryonic lethality compared to their homoplasmic counterparts .

What genetic engineering tools are available for D. hansenii manipulation?

Recent advances have significantly expanded the genetic toolkit available for D. hansenii manipulation:

  • CRISPR-Cas9 System: An efficient CRISPR/Cas9 toolbox has been developed specifically for D. hansenii, enabling precise genome editing and targeted modifications .

  • In vivo DNA Assembly: Researchers have established the feasibility of performing in vivo DNA assembly in D. hansenii. This technique allows for the fusion of up to three different DNA fragments with 30-bp homologous overlapping overhangs in a single step, streamlining the generation of transformant strains for high-throughput screenings .

  • Promoter and Terminator Screening: The in vivo DNA assembly technique has been successfully employed to screen potential promoters, terminators, and signal peptides to enhance D. hansenii's production of recombinant proteins. For instance, research has shown that the TEF1 promoter (derived from Arxula adeninivorans) and the CYC1 terminator yield high expression levels of reporter proteins such as YFP .

These tools collectively provide researchers with sophisticated capabilities for genetic manipulation of D. hansenii, facilitating studies on mitochondrial inheritance and protein expression in this non-conventional yeast.

What methods can be used to detect mitochondrial inheritance patterns in yeast models?

Several methodological approaches are employed to investigate mitochondrial inheritance patterns in yeast models:

  • MitoTracker Labeling: Mitochondria can be visualized by pre-labeling cells with MitoTracker dyes before fertilization or cell fusion events. This technique allows researchers to track the fate of parental mitochondria, as demonstrated in porcine zygote studies where sperm mitochondrial sheaths were detected at specific time points post-insemination .

  • Immunocytochemistry: This approach enables the visualization of specific proteins involved in mitochondrial inheritance. Cells are fixed and stained with antibodies against proteins of interest, allowing researchers to observe their localization patterns and potential interactions with mitochondria .

  • Western Blot Analysis: This technique is used to detect and quantify specific proteins in different cellular fractions or under varying experimental conditions. It has been applied to analyze proteins in ejaculated (non-capacitated), primed, and experimentally treated cells .

  • Mass Spectrometry: This powerful analytical technique has been employed to identify proteins involved in post-fertilization sperm mitophagy. In one study, a cell-free system was used in conjunction with mass spectrometry to identify autophagic cofactors involved in mitochondrial degradation, resulting in the identification of 185 differentially abundant proteins .

These complementary approaches provide researchers with a comprehensive toolkit for investigating the complex mechanisms underlying mitochondrial inheritance in yeast and other model organisms.

What is AIM11 and how does it function in mitochondrial inheritance?

AIM11 (Altered Inheritance of Mitochondria protein 11) belongs to a class of proteins involved in regulating mitochondrial inheritance. While specific information about AIM11 in D. hansenii is limited in the current research literature, studies of mitochondrial inheritance mechanisms have identified several key proteins involved in this process.

Research into mitochondrial inheritance has revealed various proteins that participate in the selective degradation of paternal mitochondria, including MVP, PSMG2, PSMA3, FUNDC2, SAMM50, and BAG5 . These proteins have been identified through mass spectrometry studies and are believed to function as receptors, cofactors, or substrates in post-fertilization mitophagy.

Based on our understanding of similar proteins, AIM11 likely functions within the mitochondrial membrane or in the cytosol, interacting with the mitophagy machinery to ensure proper maternal inheritance of mitochondria. Further research specifically targeting AIM11 in D. hansenii is needed to elucidate its precise role and mechanisms.

How can researchers effectively express recombinant proteins in D. hansenii?

Optimizing recombinant protein expression in D. hansenii requires careful consideration of multiple factors:

  • Promoter Selection: The choice of promoter significantly impacts expression levels. Research has demonstrated that the TEF1 promoter from Arxula adeninivorans yields high production of reporter proteins like YFP in D. hansenii .

  • Signal Peptides: When secretion of the recombinant protein is desired, appropriate signal peptides must be selected and optimized to ensure efficient protein translocation.

  • Terminator Selection: The CYC1 terminator has been shown to be effective for recombinant protein expression in D. hansenii .

  • Growth Medium Optimization: D. hansenii's halotolerance can be leveraged by cultivating it in media with elevated salt concentrations. This not only supports D. hansenii's metabolism but can also inhibit contaminating microorganisms present in industrial by-products used as growth substrates .

  • In vivo DNA Assembly: This technique allows for efficient screening of different genetic elements. Up to three different DNA fragments with 30-bp homologous overlapping overhangs can be co-transformed into D. hansenii and fused in the correct order in a single step .

The selection of these elements should be guided by the specific characteristics of the target protein and the intended application. Systematic screening approaches, facilitated by the in vivo DNA assembly technique, allow researchers to identify optimal combinations for maximizing expression levels.

What are the experimental approaches to study protein-protein interactions in mitochondrial inheritance?

Investigating protein-protein interactions involved in mitochondrial inheritance requires sophisticated experimental approaches:

  • Co-immunoprecipitation (Co-IP): This technique allows researchers to identify interactions between proteins in vivo. By using antibodies against a target protein, researchers can precipitate the protein along with any binding partners, which can then be identified by mass spectrometry or Western blotting.

  • Yeast Two-Hybrid (Y2H) System: This genetic approach allows for the detection of protein-protein interactions through the activation of reporter genes. It can be adapted for use in D. hansenii to study interactions between proteins involved in mitochondrial inheritance.

  • Bimolecular Fluorescence Complementation (BiFC): This technique allows visualization of protein interactions in living cells. Two proteins of interest are fused to complementary fragments of a fluorescent protein, which reconstitute a functional fluorophore when brought into proximity by interaction between the proteins.

  • Mass Spectrometry-Based Approaches: As demonstrated in studies of mitochondrial inheritance factors, mass spectrometry can identify proteins that differentially associate with mitochondria under specific conditions. This approach has successfully identified proteins like MVP, PSMG2, PSMA3, FUNDC2, SAMM50, and BAG5 as potential cofactors in mitochondrial inheritance .

  • Cell-Free Systems: Researchers have developed cell-free systems capable of recapitulating early fertilization proteomic interactions. These systems provide a controlled environment for studying protein interactions without the complexity of the entire cellular context .

These complementary approaches provide researchers with a toolkit for dissecting the complex protein interaction networks that govern mitochondrial inheritance in D. hansenii and other model organisms.

How does heteroplasmy affect cellular function and what are its implications for D. hansenii research?

Heteroplasmy, the presence of two or more distinct mitochondrial DNA (mtDNA) populations within a cell, has significant implications for cellular function and research applications:

  • Metabolic Deficiencies: Studies in mice and nematodes have demonstrated that heteroplasmic organisms exhibit reduced metabolic rates compared to their homoplasmic counterparts. This metabolic deficiency could potentially impact D. hansenii's ability to utilize various carbon sources, which is one of its key biotechnological advantages .

  • Reproductive Fitness: Male heteroplasmic nematodes have been found to have reduced sperm mobility, indicating impaired reproductive function. Similar effects could impact D. hansenii's growth rate and culture viability in research and industrial applications .

  • Embryonic Lethality: In heteroplasmic nematode populations, embryonic lethality was observed to be 23-fold higher than in homoplasmic controls. While not directly applicable to unicellular organisms like D. hansenii, this finding highlights the potentially severe consequences of heteroplasmy .

  • Implications for Recombinant Protein Production: If heteroplasmy affects metabolic efficiency in D. hansenii, it could impact the yields and consistency of recombinant protein production, a key research and biotechnological application of this organism.

  • Research Model Considerations: The natural maternal inheritance of mitochondria suggests evolutionary pressure against heteroplasmy. Understanding the mechanisms that maintain homoplasmy in D. hansenii could provide insights applicable to other organisms and disease states where heteroplasmy occurs .

From a research perspective, ensuring mitochondrial homoplasmy in D. hansenii cultures used for experiments is crucial for obtaining consistent and reliable results, particularly in metabolic studies and recombinant protein production.

What are the current challenges and limitations in engineering mitochondrial inheritance in D. hansenii?

Several significant challenges exist in the field of mitochondrial inheritance engineering in D. hansenii:

  • Limited Understanding of AIM11 Function: Despite advances in understanding mitochondrial inheritance, the specific role of AIM11 in D. hansenii remains incompletely characterized, hampering targeted engineering approaches.

  • Complex Protein Interaction Networks: The degradation of paternal mitochondria involves multiple proteins and pathways, including the ubiquitin-proteasome system and autophagy machinery. This complexity makes it challenging to engineer discrete changes without unintended consequences .

  • Technical Challenges in Mitochondrial Transformation: While nuclear genome modification in D. hansenii has advanced with the development of CRISPR/Cas9 tools, direct manipulation of mitochondrial DNA remains technically challenging due to the organelle's double membrane and unique genetic system .

  • Verification Challenges: Confirming successful modification of mitochondrial inheritance patterns requires sophisticated tracking methods and possibly multiple generations of observation, particularly for subtle phenotypes.

  • Potential Cellular Toxicity: As demonstrated in heteroplasmy studies in other organisms, alterations to mitochondrial inheritance can have profound effects on cellular viability and function, potentially limiting the extent to which these systems can be engineered .

  • Strain-Specific Variations: D. hansenii strains may exhibit variations in their mitochondrial inheritance mechanisms, necessitating strain-specific optimization of engineering approaches.

Addressing these challenges will require interdisciplinary approaches combining advanced genetic engineering techniques with sophisticated mitochondrial imaging and tracking methods, as well as comprehensive proteomic analyses to understand the full complement of proteins involved in mitochondrial inheritance in D. hansenii.

How can researchers optimize CRISPR/Cas9 for mitochondrial-related gene editing in D. hansenii?

Optimizing CRISPR/Cas9 for targeting genes involved in mitochondrial inheritance in D. hansenii requires several strategic considerations:

  • Guide RNA Design: For targeting genes like AIM11, researchers should design guide RNAs with high specificity and minimal off-target effects. Tools specifically calibrated for D. hansenii's genome should be used when available, or tools for closely related yeast species with appropriate parameter adjustments.

  • Delivery Methods: The recently developed CRISPR/Cas9 toolbox for D. hansenii should be utilized, with optimization of transformation protocols to account for D. hansenii's unique cell wall properties. This may include adjustments to electroporation parameters or enzymatic cell wall digestion protocols .

  • Homology-Directed Repair Templates: When precise modifications are required, homology-directed repair templates should be designed with sufficient homology arm lengths (typically 30-50 bp for D. hansenii based on successful in vivo assembly experiments) .

  • Verification Strategies: Multiple verification approaches should be employed, including:

    • PCR amplification and sequencing of the target region

    • Western blotting to confirm protein expression changes

    • Functional assays to verify altered mitochondrial inheritance patterns

  • Multiplex Editing: For studying protein interaction networks, researchers may need to target multiple genes simultaneously. The CRISPR/Cas9 system can be adapted for multiplex editing by expressing multiple guide RNAs.

  • Inducible Systems: For studying essential genes involved in mitochondrial inheritance, conditional or inducible CRISPR systems may be necessary to prevent lethal phenotypes during the engineering process.

By carefully optimizing these parameters, researchers can achieve efficient and specific targeting of genes involved in mitochondrial inheritance in D. hansenii, advancing our understanding of proteins like AIM11 and their functions.

What protocols are most effective for isolating and characterizing mitochondria from D. hansenii?

Effective isolation and characterization of mitochondria from D. hansenii requires specialized protocols adapted to this yeast's unique properties:

  • Cell Wall Disruption:

    • Enzymatic Method: Treatment with Zymolyase or similar enzymes in osmotically stabilized buffer (1M sorbitol, 50mM phosphate buffer, pH 7.5)

    • Mechanical Method: Glass bead homogenization in a suitable buffer containing protease inhibitors

  • Differential Centrifugation Protocol:

    • Low-speed centrifugation (1,000-2,000 × g) to remove unbroken cells and debris

    • Medium-speed centrifugation (12,000-15,000 × g) to pellet mitochondria

    • Further purification via sucrose gradient ultracentrifugation if necessary

  • Characterization Methods:

    • Respiratory Capacity: Oxygen consumption measurement using Clark-type electrodes

    • Membrane Potential: Assessment using fluorescent dyes like JC-1 or TMRM

    • Protein Composition: Mass spectrometry-based proteomic analysis, as demonstrated in mitochondrial inheritance studies

    • Structural Integrity: Transmission electron microscopy to verify mitochondrial morphology

    • mtDNA Analysis: PCR-based methods to assess mtDNA content and integrity

  • Protein Localization Studies:

    • Submitochondrial fractionation to separate outer membrane, inner membrane, and matrix proteins

    • Western blotting with antibodies against known mitochondrial markers and proteins of interest

    • Immunoelectron microscopy for precise localization of specific proteins

  • Functional Assays:

    • ATP synthesis capacity measurement

    • Reactive oxygen species (ROS) production assessment

    • Import assays for nuclear-encoded mitochondrial proteins

These protocols must be optimized specifically for D. hansenii, taking into account its halotolerance and potentially higher requirements for osmotic stabilization during the isolation process. The isolated mitochondria can then be used for detailed studies of proteins involved in mitochondrial inheritance, including AIM11.

How can researchers develop a high-throughput screening system for D. hansenii strains with altered mitochondrial inheritance?

Developing an efficient high-throughput screening system for identifying D. hansenii strains with altered mitochondrial inheritance requires a multi-faceted approach:

  • Reporter System Design:

    • Fluorescent Labeling: Develop strains expressing mitochondria-targeted fluorescent proteins with different spectral properties for maternal and paternal mitochondria

    • Selectable Markers: Engineer mitochondrial genomes with selectable markers that allow screening based on growth characteristics

  • Automated Imaging Platform:

    • High-content imaging systems can be programmed to identify cells with altered patterns of mitochondrial segregation

    • Machine learning algorithms can be trained to recognize normal versus altered inheritance patterns

  • Flow Cytometry-Based Screening:

    • Develop protocols for quantitative assessment of mitochondrial inheritance patterns using flow cytometry

    • Implement sorting capabilities to isolate cells with unusual mitochondrial distribution

  • Gene Expression Profiling:

    • Utilize microarray or RNA-Seq approaches to identify transcriptional signatures associated with altered mitochondrial inheritance

    • Develop RT-qPCR panels for key genes involved in mitochondrial dynamics and inheritance

  • Leveraging D. hansenii's In Vivo DNA Assembly:

    • Create libraries of strains with variations in genes of interest using the established in vivo DNA assembly technique

    • Implement parallel screening of multiple genetic constructs

  • Phenotypic Consequences Assessment:

    • Develop rapid assays for metabolic function

    • Implement growth rate measurements under various conditions

    • Assess recombinant protein production efficiency as a functional readout

The successful implementation of such a screening system would significantly accelerate research into mitochondrial inheritance mechanisms in D. hansenii and potentially reveal new functions for proteins like AIM11 in this process.

How should researchers approach contradictory data in mitochondrial inheritance studies?

When confronted with contradictory data in mitochondrial inheritance studies involving D. hansenii and proteins like AIM11, researchers should implement a systematic approach:

  • Methodological Validation:

    • Verify all experimental methods with appropriate positive and negative controls

    • Consider whether differences in experimental conditions might explain contradictory results

    • Implement standardized protocols across laboratories to minimize technique-based variability

  • Strain Verification:

    • Confirm the genetic background of D. hansenii strains used

    • Consider whether strain-specific variations might explain different experimental outcomes

    • Sequence key genomic regions to verify the absence of mutations that might influence results

  • Multi-Method Confirmation:

    • Apply complementary experimental approaches to investigate the same phenomenon

    • For example, combine fluorescence microscopy, biochemical assays, and genetic approaches

    • Consider that different methods may have different sensitivities and limitations

  • Statistical Rigor:

    • Ensure appropriate statistical analyses are applied to all data

    • Consider whether apparent contradictions might be explained by statistical variation

    • Increase sample sizes when results are ambiguous

  • Collaborative Resolution:

    • Engage in collaborative studies with laboratories reporting contradictory results

    • Exchange materials, protocols, and personnel to identify sources of variation

    • Consider joint publications that address and resolve contradictions

  • Model Refinement:

    • Develop more nuanced models that might accommodate apparently contradictory data

    • Consider whether contradictions might reflect biological complexity rather than experimental error

    • Use computational approaches to model complex interactions and test whether they can explain contradictory observations

By implementing this systematic approach, researchers can transform apparent contradictions into opportunities for deeper understanding of mitochondrial inheritance mechanisms in D. hansenii and the role of proteins like AIM11 in these processes.

What statistical approaches are most appropriate for analyzing mitochondrial inheritance patterns?

Analyzing mitochondrial inheritance patterns in D. hansenii and other model organisms requires sophisticated statistical approaches tailored to the specific experimental design:

  • Quantitative Analysis of Mitochondrial Distribution:

    • ANOVA or mixed-effects models for comparing mitochondrial segregation patterns across multiple experimental conditions

    • Non-parametric alternatives when data does not meet assumptions of normality

    • Power analysis to determine appropriate sample sizes for detecting biologically meaningful effects

  • Time-Series Analysis:

    • Longitudinal data analysis techniques for tracking mitochondrial inheritance across cell divisions

    • Growth curve modeling to correlate mitochondrial inheritance patterns with cellular growth characteristics

    • Change-point detection to identify critical timepoints in mitochondrial segregation

  • Image Analysis Approaches:

    • Automated image segmentation algorithms for quantifying mitochondrial distribution

    • Machine learning classification of normal versus altered inheritance patterns

    • Coefficient of variation analysis to quantify heterogeneity in mitochondrial inheritance

  • Mitochondrial DNA Heteroplasmy Analysis:

    • Specialized statistical approaches for quantifying heteroplasmy levels from sequencing data

    • Bayesian models to account for sequencing errors and PCR bias

    • Threshold determination for biologically significant heteroplasmy levels

  • Correlation Analysis:

    • Multiple regression approaches to correlate mitochondrial inheritance patterns with cellular phenotypes

    • Principal component analysis to identify key variables in complex datasets

    • Cluster analysis to identify distinct patterns of mitochondrial inheritance

  • Experimental Design Considerations:

    • Randomized block designs to control for batch effects

    • Factorial designs to efficiently test multiple variables simultaneously

    • Sequential experimental designs that adapt based on initial findings

These statistical approaches should be implemented in consultation with statistical experts and with careful attention to the biological questions being addressed, ensuring that the analysis approach is appropriate for the specific characteristics of D. hansenii and the experimental system being used.

How can researchers integrate proteomic and genetic data to understand AIM11 function in D. hansenii?

Integrating proteomic and genetic data provides a powerful approach to elucidate AIM11 function in D. hansenii:

  • Multi-omics Data Integration Strategies:

    • Correlation analysis between transcriptomic and proteomic data to identify co-regulated genes/proteins

    • Network analysis to place AIM11 within functional protein interaction networks

    • Pathway enrichment analysis to identify biological processes associated with AIM11

  • Comparative Genomics Approach:

    • Identify AIM11 homologs across species and correlate sequence conservation with functional domains

    • Compare genomic context of AIM11 across yeast species to identify conserved gene neighborhoods

    • Phylogenetic profiling to identify proteins that co-evolve with AIM11

  • Functional Genomics Integration:

    • Correlate genetic perturbation phenotypes (from CRISPR screens) with proteomic changes

    • Implement synthetic genetic array (SGA) analysis to identify genetic interactions

    • Use chemical genomics to identify small molecules that affect AIM11 function

  • Structural Biology Integration:

    • Generate structural predictions for AIM11 using homology modeling or AI-based approaches

    • Map post-translational modifications identified in proteomic studies onto structural models

    • Identify potential interaction interfaces for validation studies

  • Temporal Analysis:

    • Time-course experiments tracking both transcript and protein levels during mitochondrial inheritance

    • Correlation of AIM11 dynamics with changes in interacting proteins identified in proteomic studies

    • Integration with live-cell imaging data on mitochondrial dynamics

  • Data Visualization and Analysis Tools:

    • Implement Cytoscape or similar network visualization tools for integrated analysis

    • Develop custom R or Python pipelines for multi-omics data integration

    • Consider machine learning approaches to identify patterns in complex datasets

By systematically integrating these diverse data types, researchers can develop comprehensive models of AIM11 function in mitochondrial inheritance in D. hansenii, generating testable hypotheses for experimental validation.

What benchmarks should be used to evaluate successful genetic modification of D. hansenii for altered mitochondrial inheritance?

Comprehensive evaluation of genetic modifications targeting mitochondrial inheritance in D. hansenii requires multi-dimensional benchmarking:

  • Molecular Verification:

    • PCR confirmation of correct integration of genetic modifications

    • Sequencing verification of the modified locus

    • RT-qPCR or RNA-Seq to confirm altered expression levels

    • Western blotting to verify protein level changes

  • Mitochondrial Inheritance Pattern Assessment:

    • Quantitative microscopy with mitochondria-targeted fluorescent proteins

    • Time-lapse imaging to track inheritance across multiple generations

    • Quantification of mtDNA copy number and heteroplasmy levels

    • Electron microscopy to assess structural changes in mitochondria

  • Functional Consequences Evaluation:

    • Growth rate analysis under various conditions

    • Respiratory capacity measurement

    • Stress resistance profiling

    • Metabolomic analysis to identify alterations in metabolic pathways

  • Protein Interaction Network Analysis:

    • Co-immunoprecipitation to verify altered protein interactions

    • Proximity labeling approaches to identify changes in the local protein environment

    • Phosphoproteomic analysis to identify altered signaling pathways

  • Recombinant Protein Production Assessment:

    • Quantification of reporter protein expression

    • Analysis of product quality and consistency

    • Scalability testing for bioprocess applications

  • Comparative Performance Metrics:

    • Direct comparison with unmodified parental strains

    • Comparison with alternative modification strategies

    • Evaluation against theoretical models of mitochondrial inheritance

The establishment of these comprehensive benchmarks will enable researchers to rigorously evaluate the success of genetic modifications targeting AIM11 and other genes involved in mitochondrial inheritance in D. hansenii, ensuring that observed phenotypes are correctly attributed to the intended modifications.

What emerging technologies might advance our understanding of mitochondrial inheritance in D. hansenii?

Several cutting-edge technologies hold promise for advancing our understanding of mitochondrial inheritance in D. hansenii:

  • Single-Cell Omics:

    • Single-cell transcriptomics to capture cell-to-cell variation in gene expression during mitochondrial inheritance

    • Single-cell proteomics to identify protein-level changes at critical timepoints

    • Integration of single-cell data with imaging to correlate molecular profiles with cellular phenotypes

  • CRISPR Base and Prime Editing:

    • Implementation of precise editing technologies to introduce specific mutations without double-strand breaks

    • Development of D. hansenii-optimized base editors for targeted C- G to T- A conversions

    • Adaptation of prime editing for making targeted insertions, deletions, and all possible base-to-base conversions

  • Super-Resolution Microscopy:

    • Implementation of techniques like STORM, PALM, or STED for nanoscale visualization of mitochondrial dynamics

    • Multiplexed imaging to simultaneously track multiple proteins involved in inheritance

    • Correlation with electron microscopy for structural context

  • In Situ Structural Biology:

    • Cryo-electron tomography of D. hansenii cells to visualize mitochondrial inheritance machinery in native context

    • Development of proximity labeling approaches compatible with structural studies

    • Integration of structural data with functional genomics

  • Synthetic Biology Approaches:

    • Construction of minimal synthetic systems to reconstitute mitochondrial inheritance in vitro

    • Development of optogenetic tools to control mitochondrial dynamics with light

    • Design of synthetic genetic circuits to modulate inheritance patterns

  • Long-Read Sequencing:

    • Application of nanopore or PacBio sequencing for comprehensive mitochondrial genome analysis

    • Detection of structural variations and complex rearrangements

    • Direct detection of DNA modifications without bisulfite conversion

These emerging technologies, when adapted specifically for D. hansenii and integrated with existing approaches, have the potential to revolutionize our understanding of mitochondrial inheritance and the role of proteins like AIM11 in this process.

How might understanding D. hansenii's mitochondrial inheritance mechanisms impact broader research fields?

Research into D. hansenii's mitochondrial inheritance mechanisms has potential implications that extend well beyond this specific organism:

  • Fundamental Cell Biology Insights:

    • Expanded understanding of organelle inheritance mechanisms applicable across eukaryotes

    • New paradigms for protein quality control and selective degradation

    • Deeper insights into mitochondrial-nuclear communication

  • Biomedical Applications:

    • Improved understanding of mitochondrial diseases involving heteroplasmy

    • Potential therapeutic strategies for manipulating mitochondrial inheritance

    • Insights into the role of mitochondrial dysfunction in aging and degenerative diseases

  • Biotechnology Advancements:

    • Optimization of D. hansenii as a protein expression system for pharmaceuticals

    • Development of stable production strains with improved mitochondrial function

    • Creation of synthetic biology chassis with predictable inheritance patterns

  • Agricultural Applications:

    • Improved understanding of cytoplasmic inheritance relevant to crop improvement

    • Development of strategies to control mitochondrial heteroplasmy in agricultural species

    • Potential applications in biological control strategies

  • Evolutionary Biology:

    • New insights into the evolutionary pressure maintaining maternal inheritance

    • Better understanding of rare events of paternal mitochondrial leakage

    • Clarification of the role of mitochondrial inheritance in speciation

  • Computational Modeling:

    • Development of predictive models for mitochondrial segregation applicable across species

    • Integration of mitochondrial dynamics into whole-cell modeling efforts

    • New algorithms for analyzing complex inheritance patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.