Recombinant Debaryomyces hansenii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant AIM31 (UniProt ID: Q6BIT1) is a 175-amino-acid mitochondrial protein expressed in Escherichia coli with an N-terminal His tag for purification . It belongs to the respiratory supercomplex factor 1 (RCF1) family and is involved in stabilizing mitochondrial membrane complexes . Key specifications include:

PropertyDetail
Source SpeciesDebaryomyces hansenii (strain ATCC 36239/CBS 767)
Expression SystemE. coli
TagHis tag
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

Functional Roles

  • Mitochondrial Inheritance: Regulates mitochondrial distribution during cell division .

  • Respiratory Supercomplex Stability: Stabilizes complexes III and IV in the electron transport chain .

  • Stress Response: Linked to oxidative stress tolerance via interactions with catalases (e.g., DhCTA/DhCTT) .

Production and Purification

Recombinant AIM31 is synthesized using codon-optimized D. hansenii genes cloned into E. coli vectors. Key steps include:

  1. Transformation: Plasmid insertion into E. coli BL21(DE3) cells.

  2. Induction: Protein expression via IPTG induction.

  3. Purification: Ni-NTA affinity chromatography leveraging the His tag .

  4. Quality Control: SDS-PAGE and Western blot validation .

Industrial Biotechnology

  • Saline Wastewater Bioremediation: D. hansenii thrives in high-salt environments, making AIM31 a potential candidate for metabolic engineering in waste valorization .

  • Recombinant Protein Production: AIM31’s stability under osmotic stress supports scalable fermentation in non-sterile, saline media .

Biomedical Studies

  • Mitochondrial Disease Models: Used to study mitochondrial dysfunction in yeast .

  • Antioxidant Mechanisms: AIM31 interacts with catalases regulated by the DhHog1 MAP kinase pathway, offering insights into oxidative stress responses .

Challenges and Future Directions

  • Functional Redundancy: AIM31 shares roles with other RCF1 homologs, complicating knockout studies .

  • Industrial Scaling: Optimizing AIM31 expression in D. hansenii (vs. E. coli) could enhance salt-stress applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RCF1; AIM31; DEHA2G07876g; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
RCF1
Target Protein Sequence
MSRELPSSFDGKSEFDEDEMDILEKMAFKCKQQPLVPLGVIATTGAIFLATKSIRKGDRV NTQKYFRYRVGFQLATLIALVAGGYMFQVESDEQKATREEILRAKAKVRERLWIEELERK DEAMKSRKKRLEDSRAELIQAAKEGFEEEKKWTDAIENAKEEESAEGNDNKDVSN
Uniprot No.

Target Background

Function
A cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.
Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii AIM31 and what is its function in mitochondria?

AIM31, also known as Respiratory supercomplex factor 1 (RCF1), is a mitochondrial protein found in the halotolerant yeast Debaryomyces hansenii. It belongs to the "Altered Inheritance of Mitochondria" protein family, which plays critical roles in mitochondrial function and inheritance. AIM31 specifically functions as a respiratory supercomplex factor in the mitochondrial membrane, where it contributes to the organization and stability of respiratory chain complexes .

D. hansenii possesses a unique mitochondrial respiratory chain featuring both classical complexes (I–IV) and alternative oxidoreductases such as the cyanide-insensitive alternative oxidase (AOX). These components work together to enable the yeast's remarkable stress adaptation capabilities, particularly its halotolerance. AIM31, as part of this machinery, likely contributes to energy metabolism and stress response mechanisms that are essential for the organism's survival in high-salt environments.

How does AIM31 relate to the broader Altered Inheritance of Mitochondria (AIM) protein family?

The AIM protein family encompasses numerous proteins involved in mitochondrial inheritance, structure, and function. While AIM31 (RCF1) in D. hansenii remains less characterized than some family members, related proteins have been studied in other yeast species:

AIM Family MemberSpeciesKnown FunctionReference
AIM31 (RCF1)D. hanseniiRespiratory supercomplex factor
AIM36D. hanseniiStructural/functional roles (uncharacterized)
AIM21S. cerevisiaeMitochondrial genome maintenance
AIM23C. dubliniensisFunction not well-characterized

The broader AIM family in Saccharomyces cerevisiae and Candida species has been more extensively studied compared to D. hansenii, providing context for understanding potential AIM31 functions. Research in these model organisms suggests roles in mitochondrial genome integrity, protein import, and organelle inheritance mechanisms.

What expression systems and purification strategies are optimal for recombinant D. hansenii AIM31 production?

For successful expression and purification of recombinant D. hansenii AIM31, the current established methodology employs E. coli expression systems with an N-terminal His tag . This approach facilitates efficient purification through affinity chromatography.

The recommended protocol includes:

  • Cloning the AIM31 gene sequence (encoding residues 1-175) into an appropriate E. coli expression vector with an N-terminal His tag

  • Transforming the construct into a compatible E. coli strain

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the recombinant protein using nickel affinity chromatography

  • Purifying to >90% homogeneity as determined by SDS-PAGE

  • Lyophilizing the purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0

For downstream applications, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

What techniques can effectively elucidate AIM31's role in mitochondrial inheritance and function?

Investigating AIM31's precise role requires a multifaceted approach combining genetic, biochemical, and advanced imaging techniques:

  • Gene Knockout/Knockdown Studies: PCR-based homologous recombination with 50 bp flanking regions has achieved >75% integration efficiency in D. hansenii, making it a viable approach for creating AIM31 deletion mutants. Phenotypic analysis of these mutants under various stress conditions would reveal functional insights.

  • Protein-Protein Interaction Studies: Co-immunoprecipitation, yeast two-hybrid, or proximity labeling techniques can identify AIM31 interaction partners within the mitochondrial membrane and respiratory complexes.

  • Mitochondrial Inheritance Assays: Fluorescent labeling of mitochondria combined with time-lapse microscopy in wild-type versus AIM31-deficient cells can visualize inheritance defects during cell division.

  • Respiratory Function Analysis: Oxygen consumption measurements, membrane potential assays, and analysis of respiratory complex assembly in the presence/absence of AIM31 can reveal its functional significance in energy metabolism.

  • Stress Response Experiments: Given D. hansenii's halotolerance, examining AIM31's role under osmotic stress conditions is particularly relevant. Comparing wild-type and mutant growth under varying salt concentrations could highlight AIM31's contribution to stress adaptation.

How can transformation protocols be optimized for genetic manipulation of D. hansenii to study AIM31?

Genetic manipulation of D. hansenii presents notable challenges. Current transformation methods have shown limited success, as documented in various studies. Several approaches warrant consideration:

  • Improved Protoplasting Methods: Traditional protoplasting techniques have shown limited success in D. hansenii. Optimizing enzymatic digestion conditions, osmotic stabilizers, and regeneration media composition could improve transformation efficiency .

  • Electroporation Optimization: While electroporation has been attempted in D. hansenii, success rates remain low. Adjusting field strength, pulse duration, and pre-/post-electroporation handling may enhance transformation rates .

  • Alkali Cation Methods: These techniques require further optimization for D. hansenii, potentially by modifying cation concentration and exposure times .

  • Marker Selection: Using hygromycin resistance as an alternative selection marker might improve transformation outcomes, particularly with strain J-26 as suggested in previous work .

  • Auxotrophic Markers: Generating URA3-deficient strains through Ethyl Methyl Sulfonate mutagenesis provides an alternative selection system. This approach can be coupled with the URA3 gene as a selectable marker for transformation .

  • Consideration of Strain Variability: Transformation efficiency varies considerably between D. hansenii strains. The documented strain dependencies suggest testing multiple strains when establishing new transformation protocols .

How does D. hansenii AIM31 compare to homologous proteins in other yeast species?

Comparative analysis of AIM31/RCF1 across yeast species reveals important evolutionary and functional insights:

SpeciesProteinSizeKey FeaturesKnown Functions
D. hanseniiAIM31/RCF1175 aaN-terminal mitochondrial targeting sequenceRespiratory supercomplex factor
S. cerevisiaeAIM21VariableInvolved in mitochondrial maintenanceMitochondrial genome stability
C. dubliniensisAIM23Partial characterizationLimited functional data availableNot fully characterized

While the AIM protein family is better characterized in S. cerevisiae and Candida species, D. hansenii AIM31 likely shares functional similarities with these homologs, particularly in mitochondrial inheritance and respiratory chain organization. The unique adaptations of D. hansenii to high-salt environments may have driven functional specialization of its AIM proteins, including AIM31, to support mitochondrial function under osmotic stress.

What are the optimal storage and handling conditions for recombinant AIM31 protein in laboratory settings?

Proper storage and handling of recombinant D. hansenii AIM31 are critical for maintaining protein integrity and functionality in research applications:

  • Storage Recommendations:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • After reconstitution, store working aliquots at 4°C for up to one week

    • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended) and store aliquots at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles, as they can compromise protein integrity

  • Reconstitution Protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Aliquot for long-term storage to minimize freeze-thaw cycles

  • Quality Control Considerations:

    • Confirm protein purity via SDS-PAGE (should be >90%)

    • For functional studies, verify activity using appropriate assays relevant to respiratory function

What methodologies can reveal AIM31's role in D. hansenii's unique stress adaptation mechanisms?

D. hansenii's exceptional halotolerance and stress adaptation capabilities make it an ideal model for investigating mitochondrial protein functions under extreme conditions. To elucidate AIM31's specific contributions:

  • Comparative Growth Assays: Compare growth kinetics of wild-type and AIM31-deficient strains under varying salt concentrations (0-24% NaCl), pH values, and temperatures to identify specific stress conditions where AIM31 is crucial.

  • Respiratory Measurements Under Stress: Measure oxygen consumption rates and mitochondrial membrane potential in wild-type versus AIM31-deficient strains under osmotic stress to assess AIM31's role in maintaining respiratory function.

  • Reactive Oxygen Species (ROS) Analysis: Quantify ROS production in the presence and absence of AIM31 during salt stress, as mitochondrial respiratory chain components often influence ROS levels during stress responses.

  • Mitochondrial Morphology Studies: Employ fluorescence microscopy to examine mitochondrial network organization in wild-type versus AIM31-deficient strains under different salt concentrations.

  • Transcriptomic and Proteomic Profiling: Compare gene expression and protein abundance patterns between wild-type and AIM31-deficient strains under normal and stress conditions to identify AIM31-dependent stress response pathways.

D. hansenii's unique mitochondrial respiratory chain, featuring both classical complexes (I–IV) and alternative oxidoreductases like AOX, likely contributes to its remarkable stress tolerance. Understanding AIM31's role within this specialized system could reveal novel mechanisms of mitochondrial adaptation to extreme environments.

How can researchers investigate potential interactions between AIM31 and other mitochondrial proteins in D. hansenii?

Investigating AIM31's protein interaction network requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged AIM31 to pull down interaction partners, followed by mass spectrometry identification. This approach is particularly useful for detecting stable interactions within mitochondrial complexes.

  • Proximity-dependent Biotin Identification (BioID): Fusing AIM31 to a biotin ligase to label proximal proteins, which can then be purified and identified. This technique captures transient and weak interactions that might be missed by Co-IP.

  • Yeast Two-Hybrid Screening: While challenging to implement for mitochondrial membrane proteins, modified split-ubiquitin systems can be adapted for this purpose to detect binary protein interactions.

  • Genetic Interaction Mapping: Systematically combining AIM31 mutations with mutations in other mitochondrial genes to identify functional relationships through synthetic genetic interactions.

  • Blue Native PAGE: For analyzing intact mitochondrial protein complexes, particularly respiratory supercomplexes that may contain AIM31.

These techniques should focus on potential interactions with known mitochondrial components in D. hansenii, including:

  • Alternative NADH dehydrogenases (NDH2e)

  • Mitochondrial glycerol-phosphate dehydrogenase (MitGPDH)

  • Components of respiratory complexes I-IV

  • The alternative oxidase (AOX) system

What are common challenges in functional studies of recombinant D. hansenii AIM31 and how can they be addressed?

Researchers working with recombinant D. hansenii AIM31 often encounter several technical challenges:

  • Protein Solubility Issues:

    • Challenge: As a mitochondrial membrane protein, AIM31 may exhibit poor solubility when expressed recombinantly.

    • Solution: Optimize buffer conditions by testing various detergents (DDM, LDAO, etc.) at different concentrations. Consider using fusion tags designed to enhance solubility alongside the His tag.

  • Maintaining Functional Conformation:

    • Challenge: Ensuring the recombinant protein maintains its native conformation and functional properties.

    • Solution: Validate protein folding using circular dichroism spectroscopy. Consider co-expression with interacting partners or chaperones to facilitate proper folding.

  • Reconstitution into Membrane Systems:

    • Challenge: For functional studies, AIM31 may need to be incorporated into artificial membrane systems.

    • Solution: Explore proteoliposome reconstitution or nanodiscs to provide a membrane-like environment for functional assays.

  • Activity Assessment:

    • Challenge: Determining appropriate assays to measure AIM31 activity.

    • Solution: Since AIM31 functions as a respiratory supercomplex factor, consider assays that measure supercomplex stability, respiratory activity, or protein-protein interactions within the respiratory chain.

  • Species-Specific Differences:

    • Challenge: Functional properties may differ from better-characterized homologs in other yeast species.

    • Solution: Use comparative approaches, testing AIM31 alongside homologs from S. cerevisiae or C. dubliniensis to identify conserved and divergent functional properties.

How should researchers interpret contradictory data regarding AIM31 function across different experimental systems?

When faced with contradictory results regarding AIM31 function, consider these interpretative approaches:

  • Context Dependency: D. hansenii's unique halotolerance means AIM31 may exhibit different functions under varying salt concentrations or stress conditions. Systematically test function across different environmental parameters.

  • Strain Variability: Different D. hansenii strains may show variation in AIM31 expression or function. Compare results across multiple strains and clearly document the specific strain used.

  • Expression System Artifacts: E. coli-expressed recombinant AIM31 may lack critical post-translational modifications present in the native yeast context. Consider complementary studies in the native organism alongside recombinant protein work.

  • Protein Interaction Networks: AIM31 function likely depends on specific protein-protein interactions that may be disrupted in certain experimental setups. Investigate whether contradictory results stem from differences in the availability of interaction partners.

  • Technical Considerations: Variations in protein tags, purification methods, or assay conditions can significantly impact observed functions. Standardize methodologies where possible and explicitly account for technical differences when comparing results.

  • Evolutionary Perspective: D. hansenii AIM31 may have evolved specialized functions distinct from homologs in other yeast species. Seeming contradictions might reflect genuine biological differences rather than experimental artifacts.

What emerging technologies could advance our understanding of D. hansenii AIM31?

Several cutting-edge approaches hold promise for deepening our understanding of AIM31:

  • Cryo-Electron Microscopy: Determining the high-resolution structure of AIM31 within the context of respiratory supercomplexes could reveal critical insights into its mechanism of action.

  • CRISPR-Cas9 Genome Editing: Adapting CRISPR systems for D. hansenii would overcome current transformation limitations, enabling precise genetic manipulation to study AIM31 function in vivo.

  • Single-Cell Analysis: Investigating cell-to-cell variability in AIM31 expression and function could reveal heterogeneous responses to stress conditions within D. hansenii populations.

  • In situ Structural Biology: Techniques like cryo-electron tomography could visualize AIM31 within intact mitochondria, providing context for its organization within the organelle.

  • Systems Biology Approaches: Integrating transcriptomic, proteomic, and metabolomic data could position AIM31 within broader regulatory networks governing mitochondrial function and stress response.

  • Synthetic Biology: Designing minimal mitochondrial systems incorporating recombinant AIM31 could isolate its specific functions from the complexity of the entire organelle.

How might understanding D. hansenii AIM31 contribute to broader mitochondrial biology research?

Research on D. hansenii AIM31 has several potential impacts on the broader field:

  • Evolutionary Insights: As a halotolerant yeast with unique mitochondrial adaptations, D. hansenii provides an evolutionary perspective on mitochondrial protein function across diverse environments.

  • Stress Response Mechanisms: Understanding how AIM31 contributes to mitochondrial function under extreme conditions may reveal conserved stress response pathways relevant to other organisms.

  • Mitochondrial Disease Models: While primarily a yeast protein, insights from AIM31 may inform our understanding of related proteins involved in human mitochondrial diseases, particularly those affecting respiratory chain organization.

  • Biotechnological Applications: D. hansenii's exceptional stress tolerance makes it valuable for biotechnological applications. Understanding AIM31's role in this tolerance could inform strain engineering for industrial settings.

  • Mitochondrial Inheritance Principles: The AIM protein family's role in mitochondrial inheritance likely involves conserved mechanisms; studying D. hansenii AIM31 could reveal fundamental principles applicable across eukaryotes.

  • Comparative Mitochondrial Biology: Comparing AIM31 function across yeast species with different ecological niches provides insights into how mitochondrial systems adapt to diverse environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.