Recombinant Debaryomyces hansenii Altered Inheritance of Mitochondria protein 36, Mitochondrial (AIM36), is a protein expressed in Debaryomyces hansenii, a species of yeast known for its tolerance to high-salt environments and its potential use in industrial biotechnology . AIM36, also known as FMP39 or DEHA2B07414g, is a protein associated with mitochondrial function .
Debaryomyces hansenii is a psychrotolerant yeast, making it a suitable host for protein production at low temperatures . It can grow in industrial by-products rich in salt and nutrients, such as those from the dairy and pharmaceutical industries, without requiring additional supplements or freshwater . D. hansenii can produce recombinant proteins in open, non-sterile cultivations because its halotolerance hinders the growth of other microorganisms .
AIM36 is a mitochondrial protein involved in the inheritance and function of mitochondria . The full-length recombinant AIM36 protein from Debaryomyces hansenii consists of amino acids 36-279, with the UniProt ID Q6BWY8 .
| Feature | Description |
|---|---|
| Gene Name | AIM36 |
| Synonyms | AIM36; FMP39; DEHA2B07414g; Altered inheritance of mitochondria protein 36, mitochondrial; Found in mitochondria protein 39 |
| Species | Debaryomyces hansenii |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length of Mature Protein (36-279) |
| AA Sequence | QLYSTKANNEPPKLRFLFYMFIFASGVLYVTGSQIEKKKPKSSFTEKEFEEYESSSGLKRR SKLISTQDAEKYKFFVVPYVHQNEFITKIAQKLGDKEVRIIDPEELIKREREDESRHYS YLLQDLAQEDKPLPKGLVTALIKDDIKFYLNTRNGTFDTNFLIKNYPQTTDEAIKFENDI SDISKCIVLHYDMLNELKKNKGEENARLINNVVGYYETVNKAKIITAKHDELDDKLQEIS LEFI |
| UniProt ID | Q6BWY8 |
Mitochondria are essential organelles responsible for energy production and various metabolic processes in eukaryotic cells . AIM36 likely plays a role in maintaining mitochondrial integrity and function, as well as in the proper inheritance of mitochondria during cell division. Research has shown that perturbation of mitochondrial function can affect cellular processes, such as susceptibility to xenobiotics .
KEGG: dha:DEHA2B07414g
AIM36 (Altered Inheritance of Mitochondria Protein 36) in Debaryomyces hansenii is a mitochondrial protein whose specific role in mitochondrial inheritance remains largely uncharacterized. Current research utilizes recombinant AIM36 (amino acids 36-279) with an N-terminal His tag (accession number Q6BWY8) for structural and functional studies. While the AIM protein family is relatively well-characterized in Saccharomyces cerevisiae and Candida species, with proteins like AIM21 involved in mitochondrial genome maintenance in S. cerevisiae, the specific functions and interactions of AIM36 in D. hansenii remain an active area of investigation. The protein is part of the broader mitochondrial protein network that contributes to D. hansenii's unique energy metabolism and stress adaptation capabilities.
D. hansenii possesses a distinctive mitochondrial respiratory chain that features both classical complexes (I-IV) and alternative oxidoreductases like the cyanide-insensitive alternative oxidase (AOX). This unique configuration likely influences AIM36 function and interactions within the mitochondrial network. Methodologically, researchers investigating AIM36 should consider:
Comparative analysis with other yeast species using respiratory inhibitors to differentiate classical and alternative pathway contributions
Oxygen consumption measurements under various salt conditions (0-1M NaCl) to assess AIM36's role in respiration adaptation
Blue-Native PAGE followed by mass spectrometry to identify AIM36-containing protein complexes specific to D. hansenii
Mitochondrial membrane potential measurements (using TMRM or JC-1) in wild-type versus AIM36-depleted strains
Understanding these interactions is crucial as D. hansenii's mitochondrial proteins are critical for energy metabolism and adaptation to environmental stressors, particularly high salinity conditions.
The most effective expression system for recombinant AIM36 production combines E. coli for initial expression with D. hansenii as the final host. The methodology involves:
Initial cloning and expression in E. coli:
Clone AIM36 (amino acids 36-279) with an N-terminal His tag into a suitable expression vector
Express in E. coli strains optimized for mitochondrial proteins (e.g., C41(DE3) or Rosetta™)
Purify using nickel affinity chromatography
Transfer to D. hansenii using PCR-based homologous recombination:
Design primers with 50 bp flanking regions homologous to the desired integration site
Transform purified PCR products into D. hansenii
Select transformants using appropriate markers
Verify integration by PCR and sequencing
This approach achieves >75% integration efficiency and enables proper protein folding in its native environment. For large-scale production, consider using D. hansenii's TEF1 promoter (from Arxula adeninivorans) with the CYC1 terminator, which has demonstrated optimal recombinant protein expression in various studies .
Optimal AIM36 expression in D. hansenii requires carefully controlled growth conditions that leverage the yeast's unique halophilic characteristics. The methodological approach should include:
Media composition:
Growth parameters:
Temperature: 28°C (standard) for normal growth; reduce to 25°C during induction for slower, higher-quality protein expression
Aeration: Maintain high dissolved oxygen levels (>30% saturation) for optimal mitochondrial protein expression
Growth phase: Induce during early exponential phase (OD600 = 0.8-1.0)
Strain selection:
This approach is based on experimental data showing that D. hansenii exhibits improved growth and protein expression at pH 4.0 with 1M NaCl, and strain-specific responses to environmental conditions significantly impact recombinant protein yields .
Optimizing CRISPR-Cas9 gene editing for AIM36 studies requires a D. hansenii-specific approach that accounts for its unique genetic characteristics:
Guide RNA design:
Select target sites with minimal off-target potential using D. hansenii-specific prediction tools
Design gRNAs with high GC content in the seed region (last 12 nucleotides)
Validate gRNA efficiency using in silico tools before implementation
Delivery method:
Use electroporation with parameters optimized for D. hansenii (typically 1.5 kV, 200 Ω, 25 μF)
Pre-treat cells with lithium acetate and DTT to enhance transformation efficiency
Maintain cells in 1M NaCl-containing recovery media post-transformation
Repair template design:
Include homology arms of 40-50 bp for efficient integration
Incorporate silent mutations in the PAM site to prevent re-cutting
Use codon optimization specific to D. hansenii for any inserted sequences
Screening approach:
Implement a two-step PCR screening method: first for integration, then for specific mutations
Verify edited regions by sequencing to ensure accurate modifications
Assess protein expression levels in verified clones using western blotting
When combined with in vivo DNA assembly, this approach can streamline the generation of transformant strains for high-throughput screenings, allowing simultaneous testing of various promoters, terminators, and signal peptides .
Studying AIM36 under industrial by-product conditions requires specialized methodologies that capitalize on D. hansenii's unique tolerance to complex substrates:
Media preparation:
Cultivation strategy:
Analytical techniques:
Use qPCR to assess AIM36 transcript levels under various industrial waste conditions
Implement western blotting with anti-His antibodies to quantify protein expression
Analyze mitochondrial function using oxygen consumption and membrane potential measurements
Competition analysis:
Monitor D. hansenii's ability to outcompete other microorganisms present in non-sterile industrial waste
Use species-specific primers for qPCR to quantify population dynamics
Assess if competition affects AIM36 expression or mitochondrial function
This approach has been validated for recombinant protein production using D. hansenii in open (non-sterile) conditions with salt-rich by-products, where the yeast successfully outcompeted other microorganisms without compromising cell performance or protein production .
Quantitative assessment of mitochondrial inheritance in AIM36-expressing D. hansenii requires multi-faceted approaches that visualize, track, and measure mitochondrial dynamics:
Fluorescence microscopy-based methods:
Label mitochondria using MitoTracker dyes or mitochondria-targeted fluorescent proteins
Perform time-lapse imaging during cell division (every 10-15 minutes for 2-4 hours)
Quantify mitochondrial distribution between mother and daughter cells using ImageJ analysis
Calculate inheritance ratio using: (mitochondrial mass in daughter)/(total mitochondrial mass)
Flow cytometry approach:
Stain population with mitochondrial potential-sensitive dyes (e.g., JC-1, TMRM)
Sort cells by size to separate mothers and daughters
Compare mitochondrial content and activity between populations
Analyze at least 10,000 events per sample for statistical robustness
Molecular techniques:
Quantify mtDNA copy number in mother vs. daughter cells using qPCR
Target mitochondrial genes like COX1 or CYTB, normalized to nuclear DNA
Compare ratios between wild-type and AIM36-modified strains
Perform assays at multiple timepoints through the cell cycle
Biochemical assays:
Isolate mitochondria from mother and daughter cell populations
Measure respiratory chain complex activities in separate fractions
Analyze protein composition by mass spectrometry
Compare oxidative phosphorylation efficiency between populations
These methodologies together provide a comprehensive analysis of how AIM36 modifications affect the quantitative and qualitative aspects of mitochondrial inheritance in D. hansenii.
Effective bioinformatic analysis of AIM36 requires a multi-layered approach to uncover functional domains and potential interaction partners:
Sequence-based analysis:
Perform multiple sequence alignment of AIM36 orthologs across yeast species (particularly S. cerevisiae and Candida species where AIM proteins are better characterized)
Use MEME Suite to identify conserved motifs
Apply PSIPRED and DISOPRED to predict secondary structure and disordered regions
Employ SignalP and TargetP to confirm mitochondrial targeting sequences
Structural prediction:
Generate 3D structural models using AlphaFold2 or RoseTTAFold
Validate models via molecular dynamics simulations in a simulated membrane environment
Identify potential binding pockets using CASTp or SiteMap
Analyze electrostatic surface potential in relation to salt tolerance mechanisms
Interactome prediction:
Use STRING and PrePPI to predict protein-protein interactions
Implement coevolution analysis using methods like GREMLIN or EVcoupling
Cross-reference with experimental S. cerevisiae mitochondrial interactome data
Generate a ranked list of potential interactors for experimental validation
Functional annotation transfer:
Apply Gene Ontology enrichment analysis to predicted interactors
Use phylogenetic profiling to identify proteins with correlated evolutionary history
Implement network-based function prediction algorithms
Construct a mitochondrial functional interaction network centered on AIM36
This systematic approach combines evolutionary conservation, structural insights, and network analysis to develop testable hypotheses about AIM36 function in D. hansenii mitochondrial inheritance and salt adaptation.
The relationship between AIM36 function and D. hansenii's remarkable halotolerance involves sophisticated experimental approaches to elucidate the mechanistic connections:
Comparative expression analysis:
Quantify AIM36 expression under increasing salt concentrations (0M-2M NaCl) using RT-qPCR
Compare expression patterns across multiple D. hansenii strains with varying salt tolerance
Correlate AIM36 expression with growth rates and mitochondrial activity measurements
Create an expression profile heatmap across different salt concentrations and timepoints
Mitochondrial function assessment:
Measure oxygen consumption rates in wild-type vs. AIM36-modified strains at different salt concentrations
Quantify ATP production under salt stress conditions
Assess mitochondrial membrane potential changes during salt adaptation
Compare reactive oxygen species (ROS) production between strains during salt stress
Osmoprotectant interaction studies:
Investigate AIM36 relationship with glycerol production pathways
Measure Na+/K+ ratios in mitochondria isolated from wild-type vs. AIM36-modified strains
Assess mitochondrial volume changes during hyperosmotic shock
Quantify mitochondrial ion flux during salt adaptation
Stress response pathway mapping:
Perform phosphoproteomic analysis to identify AIM36 post-translational modifications during salt stress
Use chromatin immunoprecipitation to identify transcription factors regulating AIM36 during stress
Apply chemical genetics to identify synthetic interactions between AIM36 and other stress-response genes
Develop a pathway model integrating AIM36 with known halotolerance mechanisms
Experimental evidence indicates that D. hansenii exhibits improved performance under various abiotic stresses when grown in 1M NaCl, and experiences a positive and summative effect at pH 4 combined with high salt content . This suggests AIM36 may function at the intersection of pH adaptation and salt tolerance pathways within mitochondria.
Leveraging AIM36 modifications to enhance D. hansenii's performance as a cell factory requires strategic genetic and metabolic engineering approaches:
Promoter optimization framework:
Test AIM36 expression under control of various promoters including TEF1 (from Arxula adeninivorans), which has demonstrated superior recombinant protein production
Develop salt-inducible promoter systems for AIM36 to link expression with industrial conditions
Implement inducible expression systems for controlled upregulation during production phases
Quantify production efficiency using standardized reporter systems (e.g., YFP) under each condition
AIM36 engineering strategy:
Create an AIM36 variant library using site-directed mutagenesis targeting conserved domains
Develop truncated versions to identify minimal functional domains
Design fusion proteins linking AIM36 to stress-response regulators
Screen library in high-throughput format using growth rate and protein production as metrics
Metabolic integration methodology:
Map AIM36's influence on central carbon metabolism using 13C-metabolic flux analysis
Identify metabolic bottlenecks in engineered strains using transcriptomics and metabolomics
Implement genome-scale metabolic modeling to predict optimal AIM36 expression levels
Co-express complementary mitochondrial factors identified through interaction studies
Industrial condition adaptation protocol:
Develop adaptive laboratory evolution protocols targeting AIM36 function
Implement cycling between ideal and industrial conditions to select robust variants
Characterize evolved strains using whole-genome sequencing and phenotypic assays
Validate improved performance using actual industrial by-products as substrate
This approach is supported by research demonstrating D. hansenii's exceptional ability to utilize salt-rich industrial by-products for recombinant protein production , and its capacity to outcompete other microorganisms in non-sterile conditions due to its halotolerance .
Uncovering AIM36's potential role in lignocellulosic biomass utilization requires specialized experimental approaches that connect mitochondrial function with stress response pathways:
Inhibitor response profiling:
Expose wild-type and AIM36-modified strains to increasing concentrations of lignocellulosic inhibitors (furfural, HMF, vanillin)
Measure growth kinetics, lag phase duration, and maximum growth rates under each condition
Implement time-course transcriptomics to track stress response activation
Mitochondrial function analysis under inhibitor stress:
Measure oxygen consumption rates and ATP production during inhibitor exposure
Assess mitochondrial membrane potential changes using fluorescent probes
Quantify NAD+/NADH and NADP+/NADPH ratios to track redox metabolism
Monitor reactive oxygen species production and antioxidant enzyme activities
Combined stress response methodology:
Design factorial experiments testing AIM36 response to combined stressors (inhibitors + salt + low pH)
Implement response surface methodology to identify optimal tolerance conditions
Use transcriptomics to identify synergistic gene expression patterns
Develop predictive models of combined stress tolerance
Metabolic flux redirection assessment:
Trace carbon flow using 13C-labeled inhibitor compounds
Identify detoxification pathways activated in AIM36-modified strains
Map connections between inhibitor metabolism and central carbon pathways
Quantify energy allocation differences between wild-type and modified strains
These approaches are supported by research showing that 1M NaCl relieves abiotic stress caused by lignocellulosic inhibitors like furfural and HMF in D. hansenii . This suggests AIM36 may play a role in this salt-mediated protective effect, potentially through mitochondrial adaptation mechanisms.
Protein engineering to enhance AIM36 stability and function requires a systematic approach combining computational design and experimental validation:
Stability enhancement methodology:
Implement Rosetta-based computational design to identify stabilizing mutations
Focus on surface residues to enhance solubility while maintaining core function
Design salt bridges to improve stability under high ionic strength conditions
Screen variants using differential scanning fluorimetry to quantify stability improvements
Domain optimization strategy:
Perform alanine scanning mutagenesis of conserved regions
Create chimeric proteins incorporating domains from AIM homologs in salt-tolerant organisms
Design minimal functional constructs by systematic truncation
Validate domain function using yeast complementation assays
Salt adaptation engineering:
Identify salt-interacting residues through molecular dynamics simulations
Modify surface charge distribution to enhance function in high-salt environments
Engineer halophilic adaptations inspired by extremophile proteins
Test engineered variants at salt concentrations from 0-2M NaCl
Function enhancement approach:
Implement directed evolution under selective pressure
Design high-throughput screening based on mitochondrial function readouts
Combine beneficial mutations through DNA shuffling
Validate improved variants through in vivo mitochondrial inheritance assays
This engineering approach leverages D. hansenii's natural adaptation to high-salt environments, where concentrations up to 1M NaCl have been shown to have protective and non-detrimental effects . Protein engineering that enhances AIM36 stability and function under these conditions could further improve D. hansenii's utility as a cell factory for challenging industrial applications.
When traditional expression approaches for AIM36 in D. hansenii fail, several alternative strategies can be implemented:
Codon optimization methodology:
Analyze D. hansenii's codon usage bias profile
Redesign the AIM36 coding sequence using the organism's preferred codons
Focus optimization on rare codons in high-expression regions
Avoid rare codon clusters that could cause ribosome stalling
Expression vector engineering:
Test alternative promoter-terminator combinations
Optimize 5' and 3' UTR elements for enhanced translation
Include introns from highly expressed D. hansenii genes to boost expression
Engineer the ribosome binding site for optimal translation initiation
Solubility enhancement strategy:
Express AIM36 as a fusion with solubility tags (MBP, SUMO, or thioredoxin)
Include TEV or PreScission protease sites for tag removal
Test expression at reduced temperatures (20-25°C)
Supplement media with osmolytes like glycerol or sorbitol to promote proper folding
Secretion-based approach:
Add N-terminal secretion signals to redirect expression to the secretory pathway
Test various signal peptides for efficiency in D. hansenii
Create a library of different length signal sequences for optimization
Implement a two-phase cultivation strategy: growth phase at low salt, expression phase at 1M NaCl
These methods have been validated for challenging recombinant proteins in D. hansenii and capitalize on its unique physiological characteristics, including its positive response to high-salt conditions during protein expression .
Resolving data inconsistencies in AIM36 functional studies requires a systematic troubleshooting methodology:
Strain-specific variation assessment:
Environmental parameter standardization:
Develop standard operating procedures for growth conditions
Control and document key parameters:
Media composition (including trace elements)
Salt concentration (precisely measured)
pH (buffered and monitored continuously)
Temperature (±0.5°C precision)
Implement factorial design experiments to identify interaction effects between parameters
Methodological consistency framework:
Standardize protein extraction protocols specifically for mitochondrial proteins
Implement internal controls for normalization across experiments
Develop calibration standards for quantitative assays
Use automated systems when possible to reduce operator variability
Reproducibility enhancement plan:
Increase biological replicate numbers (minimum n=5)
Perform power analysis to determine appropriate sample sizes
Implement blinding procedures for analysis phases
Establish collaborative validation with independent laboratories
This approach addresses the significant strain-specific and condition-dependent variations observed in D. hansenii experimental systems . Research has demonstrated that different D. hansenii strains can exhibit markedly different responses to identical environmental conditions, which may explain inconsistencies in AIM36 functional data .
Distinguishing between direct and indirect effects of AIM36 on mitochondrial function requires sophisticated analytical techniques and careful experimental design:
Temporal resolution methodology:
Implement time-course experiments with high-frequency sampling
Apply principal component analysis to identify primary response variables
Use mathematical modeling to resolve rapid (direct) versus delayed (indirect) effects
Compare response kinetics between wild-type and AIM36-modified strains
Spatial localization approach:
Utilize super-resolution microscopy to track AIM36 localization during functional changes
Implement proximity labeling techniques (BioID or APEX) to identify direct interaction partners
Use fluorescence resonance energy transfer (FRET) to confirm direct protein-protein interactions
Correlate subcellular localization changes with functional outcomes
Biochemical interaction validation:
Develop in vitro reconstitution assays using purified components
Implement surface plasmon resonance to measure direct binding interactions
Use isothermal titration calorimetry to quantify binding thermodynamics
Apply hydrogen-deuterium exchange mass spectrometry to map interaction surfaces
Genetic dissection strategy:
Create point mutants affecting specific AIM36 functions
Implement domain swapping experiments
Use synthetic genetic array analysis to identify genetic interactions
Apply CRISPR interference for transient, tunable knockdowns
These approaches collectively provide multiple lines of evidence to distinguish direct molecular interactions from downstream pathway effects. This is particularly important when studying proteins like AIM36, which function within complex mitochondrial networks where perturbations can have wide-ranging consequences throughout cellular metabolism .