Recombinant Debaryomyces hansenii Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Debaryomyces hansenii Altered Inheritance of Mitochondria protein 36, Mitochondrial (AIM36), is a protein expressed in Debaryomyces hansenii, a species of yeast known for its tolerance to high-salt environments and its potential use in industrial biotechnology . AIM36, also known as FMP39 or DEHA2B07414g, is a protein associated with mitochondrial function .

Characteristics of Debaryomyces hansenii

Debaryomyces hansenii is a psychrotolerant yeast, making it a suitable host for protein production at low temperatures . It can grow in industrial by-products rich in salt and nutrients, such as those from the dairy and pharmaceutical industries, without requiring additional supplements or freshwater . D. hansenii can produce recombinant proteins in open, non-sterile cultivations because its halotolerance hinders the growth of other microorganisms .

AIM36 Protein Information

AIM36 is a mitochondrial protein involved in the inheritance and function of mitochondria . The full-length recombinant AIM36 protein from Debaryomyces hansenii consists of amino acids 36-279, with the UniProt ID Q6BWY8 .

Table 1: AIM36 Protein Details

FeatureDescription
Gene NameAIM36
SynonymsAIM36; FMP39; DEHA2B07414g; Altered inheritance of mitochondria protein 36, mitochondrial; Found in mitochondria protein 39
SpeciesDebaryomyces hansenii
SourceE. coli
TagHis
Protein LengthFull Length of Mature Protein (36-279)
AA SequenceQLYSTKANNEPPKLRFLFYMFIFASGVLYVTGSQIEKKKPKSSFTEKEFEEYESSSGLKRR SKLISTQDAEKYKFFVVPYVHQNEFITKIAQKLGDKEVRIIDPEELIKREREDESRHYS YLLQDLAQEDKPLPKGLVTALIKDDIKFYLNTRNGTFDTNFLIKNYPQTTDEAIKFENDI SDISKCIVLHYDMLNELKKNKGEENARLINNVVGYYETVNKAKIITAKHDELDDKLQEIS LEFI
UniProt IDQ6BWY8

Role in Mitochondrial Function

Mitochondria are essential organelles responsible for energy production and various metabolic processes in eukaryotic cells . AIM36 likely plays a role in maintaining mitochondrial integrity and function, as well as in the proper inheritance of mitochondria during cell division. Research has shown that perturbation of mitochondrial function can affect cellular processes, such as susceptibility to xenobiotics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped on blue ice packs by default. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AIM36; FMP39; DEHA2B07414g; Altered inheritance of mitochondria protein 36, mitochondrial; Found in mitochondria protein 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-279
Protein Length
Full Length of Mature Protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
AIM36
Target Protein Sequence
QLYSTKANNEPPKLRFLFYMFIFASGVLYVTGSQIEKKKPKSSFTEKEFEEYESSSGLKR RSKLISTQDAEKYKFFVVPYVHQNEFITKIAQKLGDKEVRIIDPEELIKREREDESRHYS YLLQDLAQEDKPLPKGLVTALIKDDIKFYLNTRNGTFDTNFLIKNYPQTTDEAIKFENDI SDISKCIVLHYDMLNELKKNKGEENARLINNVVGYYETVNKAKIITAKHDELDDKLQEIS LEFI
Uniprot No.

Target Background

Database Links
Protein Families
AIM36 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the current state of knowledge regarding AIM36 in D. hansenii?

AIM36 (Altered Inheritance of Mitochondria Protein 36) in Debaryomyces hansenii is a mitochondrial protein whose specific role in mitochondrial inheritance remains largely uncharacterized. Current research utilizes recombinant AIM36 (amino acids 36-279) with an N-terminal His tag (accession number Q6BWY8) for structural and functional studies. While the AIM protein family is relatively well-characterized in Saccharomyces cerevisiae and Candida species, with proteins like AIM21 involved in mitochondrial genome maintenance in S. cerevisiae, the specific functions and interactions of AIM36 in D. hansenii remain an active area of investigation. The protein is part of the broader mitochondrial protein network that contributes to D. hansenii's unique energy metabolism and stress adaptation capabilities.

How does D. hansenii's unique mitochondrial biology affect AIM36 function?

D. hansenii possesses a distinctive mitochondrial respiratory chain that features both classical complexes (I-IV) and alternative oxidoreductases like the cyanide-insensitive alternative oxidase (AOX). This unique configuration likely influences AIM36 function and interactions within the mitochondrial network. Methodologically, researchers investigating AIM36 should consider:

  • Comparative analysis with other yeast species using respiratory inhibitors to differentiate classical and alternative pathway contributions

  • Oxygen consumption measurements under various salt conditions (0-1M NaCl) to assess AIM36's role in respiration adaptation

  • Blue-Native PAGE followed by mass spectrometry to identify AIM36-containing protein complexes specific to D. hansenii

  • Mitochondrial membrane potential measurements (using TMRM or JC-1) in wild-type versus AIM36-depleted strains

Understanding these interactions is crucial as D. hansenii's mitochondrial proteins are critical for energy metabolism and adaptation to environmental stressors, particularly high salinity conditions.

What expression systems are most effective for producing recombinant AIM36?

The most effective expression system for recombinant AIM36 production combines E. coli for initial expression with D. hansenii as the final host. The methodology involves:

  • Initial cloning and expression in E. coli:

    • Clone AIM36 (amino acids 36-279) with an N-terminal His tag into a suitable expression vector

    • Express in E. coli strains optimized for mitochondrial proteins (e.g., C41(DE3) or Rosetta™)

    • Purify using nickel affinity chromatography

  • Transfer to D. hansenii using PCR-based homologous recombination:

    • Design primers with 50 bp flanking regions homologous to the desired integration site

    • Transform purified PCR products into D. hansenii

    • Select transformants using appropriate markers

    • Verify integration by PCR and sequencing

This approach achieves >75% integration efficiency and enables proper protein folding in its native environment. For large-scale production, consider using D. hansenii's TEF1 promoter (from Arxula adeninivorans) with the CYC1 terminator, which has demonstrated optimal recombinant protein expression in various studies .

What growth conditions optimize AIM36 expression in D. hansenii?

Optimal AIM36 expression in D. hansenii requires carefully controlled growth conditions that leverage the yeast's unique halophilic characteristics. The methodological approach should include:

  • Media composition:

    • Base medium: YNB or YPD supplemented with 1M NaCl (optimal salt concentration)

    • Carbon source: Glucose (preferred) at 2% concentration

    • pH: 4.0 (demonstrated to have a positive and summative effect with high salt)

  • Growth parameters:

    • Temperature: 28°C (standard) for normal growth; reduce to 25°C during induction for slower, higher-quality protein expression

    • Aeration: Maintain high dissolved oxygen levels (>30% saturation) for optimal mitochondrial protein expression

    • Growth phase: Induce during early exponential phase (OD600 = 0.8-1.0)

  • Strain selection:

    • Consider screening multiple D. hansenii strains for AIM36 expression as significant strain-specific differences exist

    • Strains like IBT27 have demonstrated superior performance under combined stress conditions

This approach is based on experimental data showing that D. hansenii exhibits improved growth and protein expression at pH 4.0 with 1M NaCl, and strain-specific responses to environmental conditions significantly impact recombinant protein yields .

How can CRISPR-Cas9 gene editing be optimized for AIM36 studies in D. hansenii?

Optimizing CRISPR-Cas9 gene editing for AIM36 studies requires a D. hansenii-specific approach that accounts for its unique genetic characteristics:

  • Guide RNA design:

    • Select target sites with minimal off-target potential using D. hansenii-specific prediction tools

    • Design gRNAs with high GC content in the seed region (last 12 nucleotides)

    • Validate gRNA efficiency using in silico tools before implementation

  • Delivery method:

    • Use electroporation with parameters optimized for D. hansenii (typically 1.5 kV, 200 Ω, 25 μF)

    • Pre-treat cells with lithium acetate and DTT to enhance transformation efficiency

    • Maintain cells in 1M NaCl-containing recovery media post-transformation

  • Repair template design:

    • Include homology arms of 40-50 bp for efficient integration

    • Incorporate silent mutations in the PAM site to prevent re-cutting

    • Use codon optimization specific to D. hansenii for any inserted sequences

  • Screening approach:

    • Implement a two-step PCR screening method: first for integration, then for specific mutations

    • Verify edited regions by sequencing to ensure accurate modifications

    • Assess protein expression levels in verified clones using western blotting

When combined with in vivo DNA assembly, this approach can streamline the generation of transformant strains for high-throughput screenings, allowing simultaneous testing of various promoters, terminators, and signal peptides .

What methodologies are effective for studying AIM36 under industrial by-product conditions?

Studying AIM36 under industrial by-product conditions requires specialized methodologies that capitalize on D. hansenii's unique tolerance to complex substrates:

  • Media preparation:

    • Use salt-rich industrial by-products without sterilization or freshwater addition

    • Options include dairy saline whey by-products, pharmaceutical industry waste, or other high-salt industrial streams

    • Monitor salt content and adjust to approximately 1M NaCl equivalent if necessary

  • Cultivation strategy:

    • Implement multi-scale approach: begin with 1.5 mL cultures, then scale to 100 mL, and finally 500 mL volumes

    • Use non-sterile (open) cultivations to mimic industrial conditions

    • Monitor AIM36 expression via fluorescent tagging (similar to YFP approaches used for other recombinant proteins)

  • Analytical techniques:

    • Use qPCR to assess AIM36 transcript levels under various industrial waste conditions

    • Implement western blotting with anti-His antibodies to quantify protein expression

    • Analyze mitochondrial function using oxygen consumption and membrane potential measurements

  • Competition analysis:

    • Monitor D. hansenii's ability to outcompete other microorganisms present in non-sterile industrial waste

    • Use species-specific primers for qPCR to quantify population dynamics

    • Assess if competition affects AIM36 expression or mitochondrial function

This approach has been validated for recombinant protein production using D. hansenii in open (non-sterile) conditions with salt-rich by-products, where the yeast successfully outcompeted other microorganisms without compromising cell performance or protein production .

How can mitochondrial inheritance be quantitatively assessed in AIM36-expressing D. hansenii?

Quantitative assessment of mitochondrial inheritance in AIM36-expressing D. hansenii requires multi-faceted approaches that visualize, track, and measure mitochondrial dynamics:

  • Fluorescence microscopy-based methods:

    • Label mitochondria using MitoTracker dyes or mitochondria-targeted fluorescent proteins

    • Perform time-lapse imaging during cell division (every 10-15 minutes for 2-4 hours)

    • Quantify mitochondrial distribution between mother and daughter cells using ImageJ analysis

    • Calculate inheritance ratio using: (mitochondrial mass in daughter)/(total mitochondrial mass)

  • Flow cytometry approach:

    • Stain population with mitochondrial potential-sensitive dyes (e.g., JC-1, TMRM)

    • Sort cells by size to separate mothers and daughters

    • Compare mitochondrial content and activity between populations

    • Analyze at least 10,000 events per sample for statistical robustness

  • Molecular techniques:

    • Quantify mtDNA copy number in mother vs. daughter cells using qPCR

    • Target mitochondrial genes like COX1 or CYTB, normalized to nuclear DNA

    • Compare ratios between wild-type and AIM36-modified strains

    • Perform assays at multiple timepoints through the cell cycle

  • Biochemical assays:

    • Isolate mitochondria from mother and daughter cell populations

    • Measure respiratory chain complex activities in separate fractions

    • Analyze protein composition by mass spectrometry

    • Compare oxidative phosphorylation efficiency between populations

These methodologies together provide a comprehensive analysis of how AIM36 modifications affect the quantitative and qualitative aspects of mitochondrial inheritance in D. hansenii.

What bioinformatic approaches best identify functional domains and interactions of AIM36?

Effective bioinformatic analysis of AIM36 requires a multi-layered approach to uncover functional domains and potential interaction partners:

  • Sequence-based analysis:

    • Perform multiple sequence alignment of AIM36 orthologs across yeast species (particularly S. cerevisiae and Candida species where AIM proteins are better characterized)

    • Use MEME Suite to identify conserved motifs

    • Apply PSIPRED and DISOPRED to predict secondary structure and disordered regions

    • Employ SignalP and TargetP to confirm mitochondrial targeting sequences

  • Structural prediction:

    • Generate 3D structural models using AlphaFold2 or RoseTTAFold

    • Validate models via molecular dynamics simulations in a simulated membrane environment

    • Identify potential binding pockets using CASTp or SiteMap

    • Analyze electrostatic surface potential in relation to salt tolerance mechanisms

  • Interactome prediction:

    • Use STRING and PrePPI to predict protein-protein interactions

    • Implement coevolution analysis using methods like GREMLIN or EVcoupling

    • Cross-reference with experimental S. cerevisiae mitochondrial interactome data

    • Generate a ranked list of potential interactors for experimental validation

  • Functional annotation transfer:

    • Apply Gene Ontology enrichment analysis to predicted interactors

    • Use phylogenetic profiling to identify proteins with correlated evolutionary history

    • Implement network-based function prediction algorithms

    • Construct a mitochondrial functional interaction network centered on AIM36

This systematic approach combines evolutionary conservation, structural insights, and network analysis to develop testable hypotheses about AIM36 function in D. hansenii mitochondrial inheritance and salt adaptation.

How does AIM36 function correlate with D. hansenii's halotolerance mechanisms?

The relationship between AIM36 function and D. hansenii's remarkable halotolerance involves sophisticated experimental approaches to elucidate the mechanistic connections:

  • Comparative expression analysis:

    • Quantify AIM36 expression under increasing salt concentrations (0M-2M NaCl) using RT-qPCR

    • Compare expression patterns across multiple D. hansenii strains with varying salt tolerance

    • Correlate AIM36 expression with growth rates and mitochondrial activity measurements

    • Create an expression profile heatmap across different salt concentrations and timepoints

  • Mitochondrial function assessment:

    • Measure oxygen consumption rates in wild-type vs. AIM36-modified strains at different salt concentrations

    • Quantify ATP production under salt stress conditions

    • Assess mitochondrial membrane potential changes during salt adaptation

    • Compare reactive oxygen species (ROS) production between strains during salt stress

  • Osmoprotectant interaction studies:

    • Investigate AIM36 relationship with glycerol production pathways

    • Measure Na+/K+ ratios in mitochondria isolated from wild-type vs. AIM36-modified strains

    • Assess mitochondrial volume changes during hyperosmotic shock

    • Quantify mitochondrial ion flux during salt adaptation

  • Stress response pathway mapping:

    • Perform phosphoproteomic analysis to identify AIM36 post-translational modifications during salt stress

    • Use chromatin immunoprecipitation to identify transcription factors regulating AIM36 during stress

    • Apply chemical genetics to identify synthetic interactions between AIM36 and other stress-response genes

    • Develop a pathway model integrating AIM36 with known halotolerance mechanisms

Experimental evidence indicates that D. hansenii exhibits improved performance under various abiotic stresses when grown in 1M NaCl, and experiences a positive and summative effect at pH 4 combined with high salt content . This suggests AIM36 may function at the intersection of pH adaptation and salt tolerance pathways within mitochondria.

How can AIM36 modifications be leveraged to improve D. hansenii as a cell factory?

Leveraging AIM36 modifications to enhance D. hansenii's performance as a cell factory requires strategic genetic and metabolic engineering approaches:

  • Promoter optimization framework:

    • Test AIM36 expression under control of various promoters including TEF1 (from Arxula adeninivorans), which has demonstrated superior recombinant protein production

    • Develop salt-inducible promoter systems for AIM36 to link expression with industrial conditions

    • Implement inducible expression systems for controlled upregulation during production phases

    • Quantify production efficiency using standardized reporter systems (e.g., YFP) under each condition

  • AIM36 engineering strategy:

    • Create an AIM36 variant library using site-directed mutagenesis targeting conserved domains

    • Develop truncated versions to identify minimal functional domains

    • Design fusion proteins linking AIM36 to stress-response regulators

    • Screen library in high-throughput format using growth rate and protein production as metrics

  • Metabolic integration methodology:

    • Map AIM36's influence on central carbon metabolism using 13C-metabolic flux analysis

    • Identify metabolic bottlenecks in engineered strains using transcriptomics and metabolomics

    • Implement genome-scale metabolic modeling to predict optimal AIM36 expression levels

    • Co-express complementary mitochondrial factors identified through interaction studies

  • Industrial condition adaptation protocol:

    • Develop adaptive laboratory evolution protocols targeting AIM36 function

    • Implement cycling between ideal and industrial conditions to select robust variants

    • Characterize evolved strains using whole-genome sequencing and phenotypic assays

    • Validate improved performance using actual industrial by-products as substrate

This approach is supported by research demonstrating D. hansenii's exceptional ability to utilize salt-rich industrial by-products for recombinant protein production , and its capacity to outcompete other microorganisms in non-sterile conditions due to its halotolerance .

What experimental approaches can uncover AIM36's role in lignocellulosic biomass utilization?

Uncovering AIM36's potential role in lignocellulosic biomass utilization requires specialized experimental approaches that connect mitochondrial function with stress response pathways:

  • Inhibitor response profiling:

    • Expose wild-type and AIM36-modified strains to increasing concentrations of lignocellulosic inhibitors (furfural, HMF, vanillin)

    • Measure growth kinetics, lag phase duration, and maximum growth rates under each condition

    • Implement time-course transcriptomics to track stress response activation

    • Quantify inhibitor detoxification rates between strains

  • Mitochondrial function analysis under inhibitor stress:

    • Measure oxygen consumption rates and ATP production during inhibitor exposure

    • Assess mitochondrial membrane potential changes using fluorescent probes

    • Quantify NAD+/NADH and NADP+/NADPH ratios to track redox metabolism

    • Monitor reactive oxygen species production and antioxidant enzyme activities

  • Combined stress response methodology:

    • Design factorial experiments testing AIM36 response to combined stressors (inhibitors + salt + low pH)

    • Implement response surface methodology to identify optimal tolerance conditions

    • Use transcriptomics to identify synergistic gene expression patterns

    • Develop predictive models of combined stress tolerance

  • Metabolic flux redirection assessment:

    • Trace carbon flow using 13C-labeled inhibitor compounds

    • Identify detoxification pathways activated in AIM36-modified strains

    • Map connections between inhibitor metabolism and central carbon pathways

    • Quantify energy allocation differences between wild-type and modified strains

These approaches are supported by research showing that 1M NaCl relieves abiotic stress caused by lignocellulosic inhibitors like furfural and HMF in D. hansenii . This suggests AIM36 may play a role in this salt-mediated protective effect, potentially through mitochondrial adaptation mechanisms.

How can protein engineering improve AIM36 stability and function?

Protein engineering to enhance AIM36 stability and function requires a systematic approach combining computational design and experimental validation:

  • Stability enhancement methodology:

    • Implement Rosetta-based computational design to identify stabilizing mutations

    • Focus on surface residues to enhance solubility while maintaining core function

    • Design salt bridges to improve stability under high ionic strength conditions

    • Screen variants using differential scanning fluorimetry to quantify stability improvements

  • Domain optimization strategy:

    • Perform alanine scanning mutagenesis of conserved regions

    • Create chimeric proteins incorporating domains from AIM homologs in salt-tolerant organisms

    • Design minimal functional constructs by systematic truncation

    • Validate domain function using yeast complementation assays

  • Salt adaptation engineering:

    • Identify salt-interacting residues through molecular dynamics simulations

    • Modify surface charge distribution to enhance function in high-salt environments

    • Engineer halophilic adaptations inspired by extremophile proteins

    • Test engineered variants at salt concentrations from 0-2M NaCl

  • Function enhancement approach:

    • Implement directed evolution under selective pressure

    • Design high-throughput screening based on mitochondrial function readouts

    • Combine beneficial mutations through DNA shuffling

    • Validate improved variants through in vivo mitochondrial inheritance assays

This engineering approach leverages D. hansenii's natural adaptation to high-salt environments, where concentrations up to 1M NaCl have been shown to have protective and non-detrimental effects . Protein engineering that enhances AIM36 stability and function under these conditions could further improve D. hansenii's utility as a cell factory for challenging industrial applications.

How can AIM36 be successfully expressed in D. hansenii when traditional approaches fail?

When traditional expression approaches for AIM36 in D. hansenii fail, several alternative strategies can be implemented:

  • Codon optimization methodology:

    • Analyze D. hansenii's codon usage bias profile

    • Redesign the AIM36 coding sequence using the organism's preferred codons

    • Focus optimization on rare codons in high-expression regions

    • Avoid rare codon clusters that could cause ribosome stalling

  • Expression vector engineering:

    • Test alternative promoter-terminator combinations

      • Strong constitutive options: TEF1 promoter from A. adeninivorans with CYC1 terminator

      • Inducible options: GAL1 promoter variants adapted for D. hansenii

    • Optimize 5' and 3' UTR elements for enhanced translation

    • Include introns from highly expressed D. hansenii genes to boost expression

    • Engineer the ribosome binding site for optimal translation initiation

  • Solubility enhancement strategy:

    • Express AIM36 as a fusion with solubility tags (MBP, SUMO, or thioredoxin)

    • Include TEV or PreScission protease sites for tag removal

    • Test expression at reduced temperatures (20-25°C)

    • Supplement media with osmolytes like glycerol or sorbitol to promote proper folding

  • Secretion-based approach:

    • Add N-terminal secretion signals to redirect expression to the secretory pathway

    • Test various signal peptides for efficiency in D. hansenii

    • Create a library of different length signal sequences for optimization

    • Implement a two-phase cultivation strategy: growth phase at low salt, expression phase at 1M NaCl

These methods have been validated for challenging recombinant proteins in D. hansenii and capitalize on its unique physiological characteristics, including its positive response to high-salt conditions during protein expression .

What are the best approaches to resolve data inconsistencies in AIM36 functional studies?

Resolving data inconsistencies in AIM36 functional studies requires a systematic troubleshooting methodology:

  • Strain-specific variation assessment:

    • Test AIM36 function across multiple D. hansenii strains

    • Document strain backgrounds and histories thoroughly

    • Implement strain typing using MALDI-TOF or molecular methods to ensure strain identity

    • Quantify strain-specific differences in mitochondrial biology as baseline data

  • Environmental parameter standardization:

    • Develop standard operating procedures for growth conditions

    • Control and document key parameters:

      • Media composition (including trace elements)

      • Salt concentration (precisely measured)

      • pH (buffered and monitored continuously)

      • Temperature (±0.5°C precision)

    • Implement factorial design experiments to identify interaction effects between parameters

  • Methodological consistency framework:

    • Standardize protein extraction protocols specifically for mitochondrial proteins

    • Implement internal controls for normalization across experiments

    • Develop calibration standards for quantitative assays

    • Use automated systems when possible to reduce operator variability

  • Reproducibility enhancement plan:

    • Increase biological replicate numbers (minimum n=5)

    • Perform power analysis to determine appropriate sample sizes

    • Implement blinding procedures for analysis phases

    • Establish collaborative validation with independent laboratories

This approach addresses the significant strain-specific and condition-dependent variations observed in D. hansenii experimental systems . Research has demonstrated that different D. hansenii strains can exhibit markedly different responses to identical environmental conditions, which may explain inconsistencies in AIM36 functional data .

What analytical techniques best distinguish between direct and indirect effects of AIM36 on mitochondrial function?

Distinguishing between direct and indirect effects of AIM36 on mitochondrial function requires sophisticated analytical techniques and careful experimental design:

  • Temporal resolution methodology:

    • Implement time-course experiments with high-frequency sampling

    • Apply principal component analysis to identify primary response variables

    • Use mathematical modeling to resolve rapid (direct) versus delayed (indirect) effects

    • Compare response kinetics between wild-type and AIM36-modified strains

  • Spatial localization approach:

    • Utilize super-resolution microscopy to track AIM36 localization during functional changes

    • Implement proximity labeling techniques (BioID or APEX) to identify direct interaction partners

    • Use fluorescence resonance energy transfer (FRET) to confirm direct protein-protein interactions

    • Correlate subcellular localization changes with functional outcomes

  • Biochemical interaction validation:

    • Develop in vitro reconstitution assays using purified components

    • Implement surface plasmon resonance to measure direct binding interactions

    • Use isothermal titration calorimetry to quantify binding thermodynamics

    • Apply hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Genetic dissection strategy:

    • Create point mutants affecting specific AIM36 functions

    • Implement domain swapping experiments

    • Use synthetic genetic array analysis to identify genetic interactions

    • Apply CRISPR interference for transient, tunable knockdowns

These approaches collectively provide multiple lines of evidence to distinguish direct molecular interactions from downstream pathway effects. This is particularly important when studying proteins like AIM36, which function within complex mitochondrial networks where perturbations can have wide-ranging consequences throughout cellular metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.