Recombinant Debaryomyces hansenii Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
COX2
Target Protein Sequence
MIWTDVPTPWGMRFQDAATPNAEGMHELYDHMMYYLALMLGLVSYMLYVMMKDYKNNTFA YKYIKHGQTLEIMWTMFPAVMLLLMAFPSFMLLYLCDEVLTPAMTVKVVGLQWYWKYEYS DFVSETGETVEYESYVMPEDMLEEGQLRLLDTDTSMVVPVDTHVRFMVTANDVLHCFTMP SLGIKVDACPGRLNQVSALMQRTGVYYGQCSELCGVNHGLMPIKTECVPIGDFVEWLGEQ ENVYVA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaboratively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. COX2 plays a crucial role in cytochrome c oxidase's catalytic reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1—a binuclear center (BNC) formed by heme a3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Database Links

KEGG: dha:cox2

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii and why is it significant for biotechnological research?

Debaryomyces hansenii is an extremophilic yeast characterized by its remarkable tolerance to high salt concentrations (up to 4M NaCl), extreme temperatures, and varying pH levels. It is classified as a non-pathogenic, metabolically versatile, osmotolerant, and oleaginous microorganism . These unique properties make D. hansenii particularly attractive for both fundamental and applied biotechnological research.

The significance of D. hansenii stems from its ability to thrive in harsh environmental conditions that would inhibit the growth of conventional yeasts like Saccharomyces cerevisiae. It plays important roles in various agro-food processes, particularly in cheese production where it is the most common yeast species found in all types of cheese . Its ability to grow in the presence of high salt concentrations at low temperatures, metabolize lactic and citric acids, and provide proteolytic and lipolytic activities during cheese ripening makes it industrially valuable .

From a research perspective, D. hansenii represents an excellent model organism for studying adaptive responses to extreme environmental conditions and for developing novel biotechnological applications utilizing industrial side-streams and complex feedstocks .

What is Cytochrome c oxidase subunit 2 (COX2) and what is its role in D. hansenii?

Cytochrome c oxidase subunit 2 (COX2) is a key component of Complex IV in the mitochondrial respiratory chain of D. hansenii. This protein is encoded by the mitochondrial genome, as confirmed through genomic exploration studies that identified the COX2 gene among several other mitochondrial genes including COX1, COX3, and cytochrome b (Cob) .

In D. hansenii, COX2 functions as part of the cytochrome c oxidase complex (Complex IV), which represents the final electron acceptor in the respiratory chain. This complex catalyzes the reduction of molecular oxygen to water while simultaneously pumping protons across the inner mitochondrial membrane, contributing to the electrochemical gradient used for ATP synthesis .

What makes COX2 particularly interesting in D. hansenii is its role within a uniquely branched respiratory chain. Unlike conventional yeasts, D. hansenii possesses a respiratory system containing both the classical complexes (I, II, III, and IV) and alternative pathways including a cyanide-insensitive, AMP-activated alternative oxidase (AOX) . This respiratory flexibility likely contributes to the yeast's ability to adapt to various environmental stresses.

What methods are commonly used to isolate and purify recombinant proteins from D. hansenii?

Isolation and purification of recombinant proteins from D. hansenii typically involves a multi-step process tailored to the characteristics of both the target protein and the unique properties of this yeast:

  • Culture optimization: D. hansenii cultures can be grown in various media, including complex industrial by-products rich in salt. For recombinant protein production, optimal conditions typically involve using by-products from the dairy or pharmaceutical industries, which can support growth without requiring nutritional supplements or freshwater .

  • Expression system selection: The choice of promoter significantly affects recombinant protein yields. Recent research has shown that heterologous promoters such as TEF1 from Arxula adeninivorans combined with the CYC1 terminator from Saccharomyces cerevisiae provide high expression levels in D. hansenii .

  • Protein secretion: For easier purification, secretion of recombinant proteins into the culture medium is advantageous. D. hansenii can efficiently secrete heterologous proteins using the α-mating factor signal peptide from S. cerevisiae, with proteins remaining stable in the supernatant for extended periods (up to 140 hours) despite high salt concentrations (1M NaCl) .

  • Cell disruption: For non-secreted proteins, cell disruption is necessary and typically involves mechanical methods such as glass bead homogenization or high-pressure homogenization, optimized for D. hansenii's robust cell wall.

  • Purification strategies: Standard chromatography techniques are applicable, though protocols must be adapted for the high salt environment. Affinity chromatography using tagged recombinant proteins is effective, followed by size exclusion or ion exchange chromatography for further purification.

  • Salt considerations: Throughout the purification process, maintaining appropriate salt concentrations is crucial, as sudden changes in ionic strength may affect protein stability and conformation, particularly for proteins adapted to D. hansenii's high-salt intracellular environment.

How does the mitochondrial respiratory chain organization in D. hansenii influence the function and interactions of recombinant COX2?

The mitochondrial respiratory chain in D. hansenii exhibits a unique organization characterized by the presence of both classical and alternative pathways, which directly influences COX2 function and interactions:

  • Supercomplex formation: D. hansenii forms respiratory supercomplexes containing complexes I, III, and IV in various stoichiometries. Research has identified several supercomplex arrangements including IV₂, I-IV, III₂-IV₄, I-III₂, I-III₂-IV, I-III₂-IV₂, I-III₂-IV₃, and I-III₂-IV₄ . COX2, as a component of complex IV, participates in these supercomplexes, which likely enhances electron transfer efficiency and provides stability in high-salt environments.

  • Dual electron flow pathways: D. hansenii possesses both the cytochrome pathway (including COX2) and alternative oxidase (AOX). While AOX appears to be constitutively expressed, most electrons preferentially flow through the cytochrome pathway under normal conditions . This suggests that COX2 and other cytochrome c oxidase subunits remain the primary components for respiratory function despite the presence of alternative pathways.

  • Impact on recombinant expression: When expressing recombinant COX2, researchers must consider how the protein will integrate into existing respiratory chain complexes. The native assembly machinery for complex IV involves multiple chaperones and assembly factors that recognize specific features of COX2. Recombinant versions must preserve these interaction domains to ensure proper integration.

  • Alternative oxidoreductases: The presence of alternative NADH dehydrogenase (NDH2e) and mitochondrial glycerol-phosphate dehydrogenase (MitGPDH) in D. hansenii creates alternative entry points for electrons into the respiratory chain . These enzymes lack proton-pumping activity and are located on the outer face of the inner mitochondrial membrane. When studying recombinant COX2 function, researchers must account for these alternative pathways that may influence electron flow to complex IV.

  • Supramolecular organization: Unlike the alternative enzymes (which appear to function independently), COX2 participates in higher-order structures. Mass spectrometry and in-gel activity studies have confirmed that complex IV integrates into defined supercomplexes, suggesting that COX2 functions within a structured respiratory network rather than as an isolated enzyme .

What genetic engineering strategies are most effective for optimizing recombinant COX2 expression in D. hansenii?

Optimizing recombinant COX2 expression in D. hansenii requires specialized genetic engineering approaches that account for the yeast's unique characteristics:

  • CRISPR/Cas9 engineering: Recent development of CRISPR-CUG/Cas9 toolboxes specifically designed for D. hansenii has revolutionized genetic engineering in this organism . This system can be used for precise genomic integration of recombinant COX2 constructs, either replacing the native gene or integrating at neutral genomic sites.

  • In vivo DNA assembly: D. hansenii can perform in vivo DNA assembly of up to three different DNA fragments with 30-bp homologous overlapping overhangs . This technique enables efficient screening of various expression constructs in a single transformation step, allowing researchers to rapidly optimize:

    • Promoter-gene-terminator combinations

    • Signal peptides for secretion (if applicable)

    • Fusion tags for detection and purification

  • Promoter selection: The TEF1 promoter from Arxula adeninivorans has shown superior performance for heterologous protein expression in D. hansenii compared to native promoters . For recombinant COX2, which normally has coordinated expression with other respiratory chain components, researchers might consider:

    PromoterOriginRelative StrengthBest Application
    TEF1A. adeninivoransVery highConstitutive high-level expression
    GPDS. cerevisiaeHighConstitutive expression
    GAL1S. cerevisiaeInducible (high)Controlled expression
    CYC1S. cerevisiaeModerateBalanced expression
    Native COX2D. hanseniiRegulatedPhysiological expression pattern
  • Codon optimization: D. hansenii has distinct codon usage preferences compared to S. cerevisiae. Optimizing the COX2 coding sequence according to D. hansenii's codon bias can significantly improve translation efficiency and protein yields.

  • Terminator influence: The CYC1 terminator from S. cerevisiae has demonstrated excellent performance in D. hansenii expression systems . For mitochondrial proteins like COX2, proper termination and transcript stability are particularly important.

  • Multi-copy integration: For increased expression levels, multi-copy integration of the recombinant COX2 gene can be achieved using auxotrophic markers or dominant selection markers functional in D. hansenii's high-salt environment.

How does the halotolerant nature of D. hansenii affect the structural stability and functional properties of recombinant COX2?

The halotolerant characteristics of D. hansenii have profound implications for the structural stability and functional properties of recombinant COX2:

What analytical techniques are most effective for characterizing the structure-function relationship of recombinant D. hansenii COX2?

Characterizing the structure-function relationship of recombinant D. hansenii COX2 requires specialized analytical approaches:

  • Blue Native PAGE and in-gel activity assays: This technique has proven valuable for analyzing respiratory supercomplexes in D. hansenii . For recombinant COX2, it can determine:

    • Whether the protein properly integrates into complex IV

    • If complex IV containing recombinant COX2 assembles into supercomplexes

    • The enzymatic activity of COX2-containing complexes directly in the gel

  • Mass spectrometry approaches:

    • Proteomics analysis: To identify interaction partners of recombinant COX2

    • Cross-linking mass spectrometry: To map the molecular interfaces between COX2 and other respiratory chain components

    • Native mass spectrometry: To determine the intact mass and composition of protein complexes containing COX2

  • Electron microscopy techniques:

    • Cryo-EM: For high-resolution structural analysis of COX2 within the context of complex IV or supercomplexes

    • Immuno-electron microscopy: To localize recombinant COX2 within the mitochondrial membrane system

  • Spectroscopic methods:

    • UV-visible spectroscopy: To monitor the redox state of heme centers in complex IV

    • EPR spectroscopy: To characterize the metal centers in COX2

    • FTIR spectroscopy: To examine conformational changes in the protein under different conditions

  • Functional assays:

    • Oxygen consumption measurements: Using oxygen electrodes to quantify the activity of complex IV containing recombinant COX2

    • Membrane potential measurements: To assess proton-pumping efficiency

    • ROS production assays: To evaluate whether recombinant COX2 affects reactive oxygen species generation

  • Computational approaches:

    • Molecular dynamics simulations: To predict how salt concentrations affect COX2 structure and dynamics

    • Homology modeling: To predict structural adaptations in D. hansenii COX2 compared to other species

How does the study of D. hansenii COX2 contribute to our understanding of respiratory chain adaptations in extremophilic organisms?

Studying D. hansenii COX2 provides critical insights into respiratory adaptations in extremophilic organisms:

  • Evolutionary adaptations: D. hansenii represents an excellent model for understanding how respiratory chain components adapt to extreme environments. COX2, as a key component of complex IV, likely contains specific adaptations that enable function under high salt conditions. Comparative analysis with mesophilic yeasts can reveal:

    • Amino acid substitutions that enhance salt tolerance

    • Structural modifications that maintain protein-protein interactions in high ionic strength

    • Regulatory mechanisms that coordinate respiratory function with stress responses

  • Branched respiratory pathway significance: D. hansenii possesses both classical and alternative respiratory pathways . The relationship between COX2 (in the classical pathway) and alternative components provides insights into:

    • How respiratory flexibility contributes to stress tolerance

    • Energy conservation strategies under extreme conditions

    • Regulatory crosstalk between parallel electron transport chains

  • Supercomplex organization: The formation of respiratory supercomplexes containing complex IV (including COX2) in different stoichiometries suggests adaptive advantages:

    • Enhanced electron transfer efficiency under osmotic stress

    • Stabilization of membrane protein complexes in high-salt environments

    • Optimization of proton-pumping efficiency under energy-limiting conditions

  • Mitochondrial genome evolution: The presence of COX2 in the mitochondrial genome of D. hansenii raises questions about the evolutionary pressures that maintained this genomic organization in an extremophile, particularly considering that some yeasts have transferred mitochondrial genes to the nuclear genome.

  • Biotechnological applications: Understanding COX2 function in D. hansenii contributes to the yeast's development as a superior cell factory for biotechnological applications :

    • Enhanced respiratory efficiency could improve biomass yields on alternative carbon sources

    • Stress-tolerant respiratory chain components could function in industrial waste streams

    • Engineering improved COX2 variants could optimize energy metabolism for specific applications

What growth conditions optimize the expression of recombinant COX2 in D. hansenii?

Optimizing growth conditions for recombinant COX2 expression in D. hansenii requires careful consideration of multiple parameters:

  • Media composition: D. hansenii can utilize various carbon sources and grow in complex industrial by-products:

    Media TypeAdvantagesConsiderations for COX2 Expression
    Salt-rich industrial by-productsCost-effective, reduces contamination riskMay require screening for optimal protein expression
    Defined minimal media with saltReproducible, controlled conditionsMust include all required nutrients
    Dairy industry by-productsRich in nutrients, natural habitatComplex composition may affect reproducibility
    Pharmaceutical industry by-productsHigh salt content, reduced contaminationMay contain inhibitory compounds
  • Salt concentration optimization: While D. hansenii tolerates up to 4M NaCl, optimal recombinant protein expression requires balancing salt concentration:

    • 1-2M NaCl typically provides good growth while maintaining protein expression

    • Salt composition (NaCl vs. KCl) can affect expression levels

    • Gradually increasing salt concentration during cultivation can improve adaptation

  • Temperature effects: Temperature impacts both growth rate and protein folding:

    • 25-28°C typically provides optimal balance between growth and protein folding

    • Lower temperatures (20-22°C) may improve folding of complex membrane proteins like COX2

    • Temperature shifts can be employed (grow at 28°C, induce at lower temperature)

  • pH considerations: D. hansenii tolerates a wide pH range:

    • pH 5.5-6.5 generally supports optimal growth and protein expression

    • For mitochondrial proteins like COX2, slightly higher pH may better preserve function

    • pH stabilization is important in high-density cultures

  • Aeration strategies: As COX2 is involved in aerobic respiration:

    • High dissolved oxygen levels promote respiratory chain component expression

    • Controlled oxygen limitation can induce mitochondrial biogenesis

    • Shake flask cultures should maintain 150-200 rpm with baffled flasks

    • Bioreactors should maintain dissolved oxygen above 30% saturation

  • Cultivation scale: D. hansenii has demonstrated successful protein expression:

    • In microplate format (1.5 mL)

    • In shake flasks (500 mL)

    • In laboratory bioreactors (1 L)

    • Each scale requires specific optimization of mixing and aeration

  • Induction timing: For inducible promoter systems:

    • Induction during early-mid exponential phase typically yields highest expression

    • For constitutive promoters like TEF1, harvesting time must be optimized based on protein stability and culture density

How can researchers troubleshoot common challenges in recombinant COX2 expression and purification from D. hansenii?

Researchers encounter several common challenges when working with recombinant COX2 from D. hansenii. Here are methodological approaches to troubleshoot these issues:

  • Low expression levels:

    • Problem diagnosis: Verify transcription levels by RT-qPCR; check protein by western blot with tag-specific antibodies

    • Solution approaches:

      • Try alternative promoters (TEF1 from A. adeninivorans shows highest activity)

      • Optimize codon usage for D. hansenii

      • Consider genomic integration at multiple loci

      • Investigate if expression is toxic by monitoring growth curves

  • Improper membrane integration:

    • Problem diagnosis: Perform subcellular fractionation; check mitochondrial localization

    • Solution approaches:

      • Verify signal sequences for mitochondrial targeting

      • Use native D. hansenii COX2 signal sequences

      • Consider expressing with native flanking regions

      • Co-express with D. hansenii-specific chaperones

  • Protein instability in high-salt environments:

    • Problem diagnosis: Monitor protein levels over time in different salt concentrations

    • Solution approaches:

      • Gradually adapt cultures to increasing salt levels

      • Add stabilizing agents (glycerol, specific amino acids)

      • Design salt-tolerant protein variants based on native D. hansenii COX2

      • Consider fusion partners that enhance stability

  • Purification challenges:

    • Problem diagnosis: Analyze each purification step for protein loss

    • Solution approaches:

      • Optimize detergent selection for membrane extraction

      • Maintain salt concentration throughout purification

      • Use affinity tags positioned to avoid interference with folding

      • Consider native purification approaches that maintain complex IV integrity

  • Lack of enzymatic activity:

    • Problem diagnosis: Perform in-gel activity assays; measure oxygen consumption

    • Solution approaches:

      • Ensure proper incorporation of metal cofactors (add copper during expression)

      • Co-express with other complex IV subunits

      • Verify proper assembly into complex IV

      • Consider native isolation of entire complex rather than individual subunit

  • Contamination in open cultivation systems:

    • Problem diagnosis: Microscopic examination; selective plating

    • Solution approaches:

      • Increase salt concentration to levels that inhibit most contaminants (>1M NaCl)

      • Use industrial by-products where D. hansenii has competitive advantage

      • Implement pH control to favor D. hansenii growth

      • Consider antibiotic selection if compatible with expression system

  • Scale-up challenges:

    • Problem diagnosis: Compare protein yield and quality across scales

    • Solution approaches:

      • Maintain consistent dissolved oxygen levels during scale-up

      • Adjust mixing parameters to prevent shear damage

      • Implement fed-batch strategies to maintain optimal conditions

      • Consider the use of salt-rich industrial by-products that support growth at various scales

What are the key considerations for designing experiments to study the effects of environmental stress on D. hansenii COX2 function?

Designing experiments to investigate how environmental stressors affect D. hansenii COX2 function requires specialized methodological approaches:

  • Experimental design framework:

    • Control selection: Use S. cerevisiae COX2 as a mesophilic control

    • Variable isolation: Design experiments that modify one stress parameter while controlling others

    • Time-course analysis: Examine both acute and chronic stress responses

    • Multi-omics integration: Combine functional, proteomic, and transcriptomic data

  • Salt stress experimental design:

    • Gradient analysis: Expose cultures to 0.5M to 4M NaCl in defined increments

    • Salt type comparison: Compare effects of NaCl, KCl, and mixed salts

    • Sudden vs. gradual exposure: Design protocols for both shock and adaptation

    • Measurements: Monitor oxygen consumption, ROS production, and COX2 levels at each condition

  • Osmotic stress differentiation:

    • Non-ionic osmolytes: Use sorbitol or glycerol to create osmotic stress without ionic effects

    • Control osmolarity: Maintain equal osmotic pressure while varying ion concentrations

    • Membrane fluidity analysis: Measure changes in mitochondrial membrane properties

    • Respiratory complex stability: Assess supercomplex integrity under different osmotic conditions

  • Oxidative stress protocols:

    • Direct ROS challenges: Expose cultures to H₂O₂, paraquat, or menadione

    • Antioxidant depletion: Use BSO to deplete glutathione

    • Mitochondrial-specific stress: Use complex III inhibitors to increase mitochondrial ROS

    • COX2 redox state: Monitor oxidation state of critical cysteines in COX2

  • Temperature stress considerations:

    • Cold stress: Examine COX2 function at 4-15°C

    • Heat stress: Test upper limits (35-40°C)

    • Temperature fluctuation: Design cycling temperature protocols

    • Respiratory adaptation: Monitor changes in alternative respiratory pathway usage

  • Combined stress experiments:

    • Multi-stress design: Create matrices of combined stresses (e.g., salt+heat)

    • Stress sequence effects: Test if prior exposure to one stress affects response to another

    • Recovery protocols: Assess COX2 function during stress recovery phases

    • Cross-protection analysis: Determine if adaptation to one stress protects against others

  • Advanced analytical techniques:

    • In vivo mitochondrial imaging: Use fluorescent probes to visualize mitochondrial function

    • Respiration measurements: Employ high-resolution respirometry

    • Supercomplex analysis: Use blue native PAGE with in-gel activity assays

    • Protein-protein interaction changes: Apply crosslinking MS to map stress-induced changes

  • Genetic manipulation approaches:

    • Site-directed mutagenesis: Modify specific residues in COX2 to test salt-adaptation hypotheses

    • Domain swapping: Create chimeric proteins between D. hansenii and mesophilic COX2

    • Reporter fusions: Attach stress-sensitive reporters to monitor COX2 conformation

    • CRISPR-CUG/Cas9: Generate precise mutations to test structure-function relationships

What emerging technologies could advance the study of recombinant D. hansenii COX2 and its role in respiratory adaptation?

Several cutting-edge technologies offer promising approaches for advancing research on D. hansenii COX2:

  • Advanced structural biology tools:

    • Cryo-electron tomography: For visualizing COX2 within intact mitochondrial membranes

    • Integrative structural modeling: Combining multiple data types (cross-linking MS, cryo-EM, computational modeling) to build comprehensive structural models of salt-adapted respiratory complexes

    • Single-particle analysis: For high-resolution structures of COX2 within supercomplexes

  • Novel genetic engineering approaches:

    • Base editing technologies: For precise modification of COX2 without double-strand breaks

    • Inducible degradation systems: To study COX2 function through controlled protein depletion

    • Multiplex genome engineering: To simultaneously modify COX2 and interacting proteins

    • In vivo DNA assembly: For rapid screening of COX2 variants

  • Advanced spectroscopic techniques:

    • Single-molecule FRET: To study COX2 conformational dynamics in real-time

    • Advanced EPR techniques: To characterize metal centers in salt-adapted COX2

    • Solid-state NMR: To examine COX2 structure within membrane environments

  • Emerging 'omics' approaches:

    • Spatial proteomics: To map the precise mitochondrial localization of COX2 and interacting proteins

    • Protein thermal shift profiling: To assess how salt affects COX2 stability on a proteome-wide scale

    • Translatomics: To study the translation efficiency of COX2 under different stress conditions

  • Mitochondrial imaging innovations:

    • Super-resolution microscopy: For nanoscale visualization of respiratory complexes

    • Genetically encoded sensors: To monitor mitochondrial parameters (pH, membrane potential) in living cells

    • Correlative light and electron microscopy: To connect functional data with ultrastructural information

  • Systems biology approaches:

    • Multi-omics data integration: To develop comprehensive models of respiratory adaptation

    • Flux balance analysis: To quantify metabolic adjustments associated with COX2 modifications

    • Protein network modeling: To understand how COX2 interacts with the broader mitochondrial proteome

  • Synthetic biology applications:

    • Minimal respiratory chain design: Engineering simplified respiratory systems based on D. hansenii components

    • Orthogonal energy generation: Creating salt-resistant bioenergetic systems for biotechnology

    • Designer extremozymes: Developing COX2 variants with enhanced properties for industrial applications

How might research on D. hansenii COX2 contribute to understanding mitochondrial disease mechanisms?

Research on D. hansenii COX2 offers unique perspectives for understanding mitochondrial diseases:

  • Stress-resistant respiratory models:

    • D. hansenii COX2 functions under conditions that would impair mammalian complex IV

    • Studying how this extremophilic COX2 maintains function could reveal principles for enhancing human complex IV stability

    • Comparative analysis between human and D. hansenii COX2 could identify critical residues for disease resistance

  • Supercomplex stability insights:

    • Many mitochondrial diseases involve destabilized respiratory supercomplexes

    • D. hansenii forms diverse supercomplexes (I-III₂-IV₄, etc.) that remain stable under extreme conditions

    • Understanding these stability mechanisms could inform therapeutic approaches for supercomplex destabilization diseases

  • Alternative respiratory pathways:

    • D. hansenii possesses both classical and alternative respiratory components

    • This respiratory flexibility resembles compensatory mechanisms observed in some mitochondrial disease patients

    • Studying how D. hansenii regulates electron flow between pathways could suggest therapeutic strategies

  • ROS management strategies:

    • Complex IV dysfunction often leads to increased ROS production in mitochondrial diseases

    • D. hansenii maintains functional respiration under conditions that typically generate high ROS

    • Identifying ROS management mechanisms could provide therapeutic targets

  • Assembly factor insights:

    • COX2 assembly into complex IV requires numerous assembly factors

    • Many mitochondrial diseases result from assembly factor mutations

    • D. hansenii likely possesses specialized assembly mechanisms that function under stress

    • Characterizing these factors could reveal novel therapeutic targets

  • Protein quality control mechanisms:

    • Mitochondrial diseases often involve misfolded or damaged respiratory chain components

    • D. hansenii must possess robust quality control systems to maintain respiratory function in extreme environments

    • Identifying these mechanisms could suggest approaches for managing disease-causing protein variants

  • Mitochondrial membrane adaptation:

    • Many COX2-related diseases involve disrupted mitochondrial membrane integrity

    • D. hansenii maintains functional mitochondrial membranes despite osmotic challenges

    • Understanding these adaptations could inform membrane-targeted therapies

What potential biotechnological applications might emerge from research on recombinant D. hansenii COX2?

Research on recombinant D. hansenii COX2 could enable several innovative biotechnological applications:

  • Bioremediation technologies:

    • Salt-contaminated environments: Engineered D. hansenii strains with enhanced COX2 function could remediate industrial saline waste

    • Heavy metal bioremediation: Understanding how COX2 functions despite metal toxicity could lead to strains for metal-contaminated sites

    • Osmotic fluctuation environments: Strains optimized for respiratory efficiency could treat variable-salinity waste streams

  • Bioenergy applications:

    • Saline microbial fuel cells: D. hansenii with engineered COX2 could power microbial fuel cells in saline environments

    • Biophotovoltaics: COX2 variants could be incorporated into artificial photosynthetic systems tolerant to extreme conditions

    • Energy harvest from industrial by-products: Engineered strains could convert salt-rich waste streams to energy

  • Protein engineering platforms:

    • Extremozyme scaffolds: D. hansenii COX2 architecture could provide templates for designing salt-resistant enzymes

    • Metal-binding protein design: COX2's metal centers could inspire metal-sequestering proteins for environmental applications

    • Membrane protein stabilization: Principles from COX2 could improve stability of other membrane proteins in biotechnology

  • Diagnostic tools:

    • Environmental biosensors: Engineered D. hansenii with modified COX2 could detect environmental contaminants

    • Stress-reporting systems: COX2-based reporters could monitor cellular responses to environmental stresses

    • Metabolic state indicators: Engineered COX2 variants could report on cellular bioenergetic status

  • Industrial bioprocessing:

    • Salt-tolerant production hosts: D. hansenii with optimized respiratory efficiency could serve as production platforms in non-sterile, high-salt conditions

    • Volatile fatty acid utilization: Enhanced respiratory capacity could improve conversion of VFAs to value-added products

    • Cheese ripening applications: Controlled expression of engineered COX2 could optimize D. hansenii's natural role in cheese production

  • Pharmaceutical applications:

    • Recombinant protein production: Salt-tolerant expression systems based on D. hansenii could produce therapeutic proteins in simplified, contamination-resistant conditions

    • Novel antimicrobial targets: Understanding unique features of COX2 could reveal selective targets in pathogenic fungi

    • Mitochondrial disease models: D. hansenii could serve as a platform for testing therapeutic approaches for complex IV disorders

  • Synthetic biology applications:

    • Minimal respiratory systems: Engineering simplified respiratory chains based on D. hansenii components

    • Salt-resistant metabolic modules: Creating transferable salt-tolerance systems for other production organisms

    • Compartmentalized biocatalysis: Using D. hansenii mitochondria as specialized reaction compartments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.