Recombinant Debaryomyces hansenii Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Key Features:

ParameterDetails
Amino Acid SequenceMTNNTRGYIQLHPFHLVGPSPWPMFTSFSLMNLALSLGLTAHGYMNNNMFMLLSTMTVLY SMTLWFKDIMAESTYLGDHTVAVKRGLMQGFLMFVVSEMLMFSSLFWAFLHSALNPTVEM GMSWPPAGMEAISAAELPLLNTMILLASGVTMTYAHHALMNGNRQNTLYGFAYSTLLMVL FVMFQGLEYTYAGFTITDGVYGSTFFALTGLHGLHMMMLIMMLAMCTMRVYNYDFTNTSH VGAETTILYLHVLDVMWLFMYMIVYWWGA
Protein LengthFull-length (1–269 aa)
TagN-terminal His-tag (10xHis)
Purity>90% (SDS-PAGE) ; >85% (partial form)
FormLyophilized powder in Tris/PBS-based buffer with 6% trehalose, pH 8.0

Production and Purification

The recombinant COX3 is produced via bacterial expression systems and purified using nickel-affinity chromatography.

Applications in Research

COX3 is primarily used in biochemical studies to investigate mitochondrial function.

Primary Uses:

  1. SDS-PAGE Analysis

    • Validates protein purity and integrity post-purification .

  2. Mitochondrial Membrane Studies

    • Examines subunit interactions within cytochrome c oxidase complexes.

  3. Protein Engineering

    • Serves as a scaffold for engineering halophilic or oleaginous strains of D. hansenii .

Related Findings:

  1. Antifungal Properties

    • D. hansenii produces volatile organic compounds (VOCs) like 3-methylbutanoic acid and 2-phenylethanol, which inhibit mold growth in dairy applications .

  2. Genetic Engineering

    • CRISPR-CUG/Cas9 tools enable precise editing of D. hansenii for enhanced recombinant protein production .

  3. Industrial Relevance

    • D. hansenii strains are used in cheese brines and surface ripening, leveraging their osmotolerance and metabolic versatility .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III; Cytochrome oxidase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
COX3
Target Protein Sequence
MTNNTRGYIQLHPFHLVGPSPWPMFTSFSLMNLALSLGLTAHGYMNNNMFMLLSTMTVLY SMTLWFKDIMAESTYLGDHTVAVKRGLMQGFLMFVVSEMLMFSSLFWAFLHSALNPTVEM GMSWPPAGMEAISAAELPLLNTMILLASGVTMTYAHHALMNGNRQNTLYGFAYSTLLMVL FVMFQGLEYTYAGFTITDGVYGSTFFALTGLHGLHMMMLIMMLAMCTMRVYNYDFTNTSH VGAETTILYLHVLDVMWLFMYMIVYWWGA
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1 – a binuclear center (BNC) composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Database Links

KEGG: dha:cox3

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying COX3 in Debaryomyces hansenii?

Cytochrome c oxidase subunit III (COX3) in D. hansenii plays a crucial role in the respiratory chain and energy metabolism of this osmotolerant yeast. Studying COX3 provides valuable insights into how D. hansenii adapts to high-salt environments while maintaining respiratory efficiency. Unlike conventional yeast models, D. hansenii demonstrates exceptional tolerance to stress conditions, making its respiratory components particularly interesting for comparative genomic studies . The COX3 gene contains significant variable sites that can be utilized for species differentiation and phylogenetic analysis, similar to how COX3 functions in other organisms . Furthermore, understanding COX3 function contributes to elucidating the metabolic flexibility that allows D. hansenii to utilize complex industrial by-products as growth substrates .

How can I isolate and identify Debaryomyces hansenii strains for COX3 studies?

The isolation and correct identification of D. hansenii strains is fundamental for subsequent COX3 studies. The most reliable approach involves a combination of morphological assessment and molecular identification. Begin by isolating potential D. hansenii colonies on selective media, such as potato dextrose agar supplemented with tartaric acid. For definitive identification, amplify the D1 and D2 domains of the 26S rRNA using primers NL1 (5′-GCATATCAATAAGCGGAGGAAAAG-3′) and NL4 (5′-GGTCCGTGTTTCAAGACGG-3′) . The amplified product should be sequenced and compared with reference sequences in the National Center for Biotechnology Information (NCBI) database. When isolating from food matrices, consider that D. hansenii is commonly found in dairy and meat products due to its salt tolerance. Once identified, the isolated strains can be stored as glycerol (20%) stocks at -70°C for long-term preservation . For COX3 studies specifically, selected strains should be cultured in yeast-peptone-dextrose (YPD) broth at 25°C under aerobic conditions to ensure proper expression of respiratory components .

What PCR conditions are optimal for amplifying the COX3 gene from Debaryomyces hansenii?

Amplification of the COX3 gene from D. hansenii requires carefully optimized PCR conditions. Based on comparative genomic approaches with other yeasts and similar amplification protocols for mitochondrial genes, the following methodology is recommended:

  • Design primers targeting conserved regions flanking the COX3 gene using alignments of related yeast species.

  • Prepare genomic DNA extractions using a gentle lysis protocol to preserve mitochondrial DNA integrity.

  • Optimize PCR conditions with an initial denaturation at 94°C for 5 minutes, followed by 30-35 cycles of:

    • Denaturation: 94°C for 30 seconds

    • Annealing: 52-55°C for 45 seconds (optimized based on primer design)

    • Extension: 72°C for 1 minute (for approximately 550-600 bp amplicon)

  • Final extension at 72°C for 10 minutes

For difficult templates, adding 5-10% DMSO or using specialized polymerases for GC-rich templates may improve amplification efficiency. The expected product size for D. hansenii COX3 gene is approximately 550-600 bp, comparable to the 552-bp COX3 region documented in other organisms . Always include positive controls from verified D. hansenii strains and negative controls to ensure specificity.

How can CRISPR-Cas9 technology be applied to study COX3 function in D. hansenii?

CRISPR-Cas9 technology offers powerful approaches to elucidate COX3 function in D. hansenii through precise genome editing. A recently developed CRISPR-Cas9 toolbox specifically adapted for D. hansenii enables efficient genetic manipulations that were previously challenging in this non-conventional yeast .

For COX3 functional studies, the following CRISPR-Cas9 approaches are recommended:

  • Targeted Gene Knockout: Design guide RNAs targeting the COX3 gene and introduce them along with Cas9 and a repair template containing a selection marker. This approach allows for complete deletion or disruption of COX3 to assess its phenotypic effects.

  • Point Mutations: For studying specific amino acid residues within COX3, design repair templates with precise nucleotide changes along with silent mutations that eliminate the PAM site to prevent re-cutting.

  • Reporter Gene Fusions: Create C-terminal fusions with fluorescent proteins to study COX3 localization and expression levels under different conditions.

  • Promoter Replacements: Exchange the native COX3 promoter with controllable promoters to regulate expression levels for functional studies.

When implementing CRISPR-Cas9 in D. hansenii, optimal results are achieved with:

  • Codon-optimized Cas9 for D. hansenii

  • Guide RNAs with high on-target and low off-target scores

  • Repair templates with 50 bp homology arms on each side

  • Transformation using electroporation (1.5 kV, 200 Ω, 25 μF)

Post-editing verification should include PCR amplification of the target region, sequencing, and phenotypic characterization focusing on respiratory capacity, growth under various stress conditions, and mitochondrial membrane potential measurements .

What analytical methods provide the most accurate quantification of recombinant D. hansenii COX3 expression?

Accurate quantification of recombinant D. hansenii COX3 expression requires specialized approaches due to its membrane-embedded nature. A multi-method approach is recommended for comprehensive analysis:

Protein Level Quantification:

  • Western Blotting with Membrane Extraction:

    • Optimize membrane protein extraction using specialized detergents (DDM, CHAPS, or Triton X-100)

    • Use anti-COX3 antibodies or epitope tags (His, FLAG) if engineered into the recombinant protein

    • Include proper loading controls (other stable membrane proteins)

  • Mass Spectrometry-Based Quantification:

    • Employ targeted MS approaches like Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM)

    • Use stable isotope-labeled peptide standards derived from unique COX3 peptides

    • Account for membrane protein-specific challenges in sample preparation

Transcript Level Quantification:

  • RT-qPCR: Design primers specific to recombinant COX3 mRNA with careful validation of:

    • Amplification efficiency (should be 90-110%)

    • Primer specificity (single melt curve peak)

    • Dynamic range (at least 4 orders of magnitude)

MethodAdvantagesLimitationsRecommended Application
Western BlotDirect protein detectionSemi-quantitativeExpression confirmation
SRM/PRM MSAbsolute quantificationTechnically demandingPrecise quantification
RT-qPCRHigh sensitivityMeasures mRNA not proteinTranscriptional studies
Enzymatic ActivityFunctional assessmentIndirect measureFunctional studies

For the most comprehensive assessment, combine protein-level quantification with enzymatic activity assays measuring cytochrome c oxidase activity in isolated mitochondrial fractions, normalized to total mitochondrial protein content .

How does oxidative stress affect the expression and function of COX3 in D. hansenii?

D. hansenii exhibits remarkable resistance to oxidative stress, which has significant implications for COX3 expression and function. Under oxidative stress conditions, several regulatory mechanisms affect COX3:

  • Transcriptional Regulation: Oxidative stress triggers complex transcriptional responses in D. hansenii, including upregulation of antioxidant genes such as catalase (CAT1) and superoxide dismutase (SOD1) . Studies in related organisms suggest that COX3 transcription may be transiently downregulated during acute oxidative stress but upregulated during adaptation phases to maintain energy production while minimizing reactive oxygen species (ROS) generation.

  • Post-translational Modifications: Oxidative stress can induce various post-translational modifications to COX3, including oxidation of critical residues that may alter protein function. These modifications can be analyzed using redox proteomics approaches.

  • Mitochondrial Membrane Integrity: H₂O₂ exposure (30 mM) significantly affects mitochondrial membrane potential in D. hansenii, which directly impacts COX3 function and the entire respiratory chain .

Experimental studies demonstrate that pretreatment with protective compounds such as mannitol (0.1 M) or sorbitol (0.1 M) significantly enhances D. hansenii's tolerance to oxidative stress by:

These protective mechanisms likely preserve COX3 function during oxidative challenge, maintaining respiratory capacity. When studying COX3 under oxidative stress, it's crucial to monitor both expression levels and functional parameters while considering the broader cellular context of stress response pathways .

What are the key considerations for designing experiments to analyze COX3 mutations in D. hansenii?

Designing robust experiments to analyze COX3 mutations in D. hansenii requires careful consideration of multiple factors to ensure meaningful results. The following experimental design framework is recommended:

  • Mutation Selection Strategy:

    • Target conserved residues identified through multi-species alignments

    • Focus on regions with known functional importance (proton channels, heme-binding sites)

    • Include both severe mutations (deletions, frameshifts) and subtle mutations (conservative amino acid substitutions)

    • Design at least 3-5 different mutations to establish functional patterns

  • Genetic Modification Approach:

    • Utilize the PCR-based gene targeting method with 50 bp homologous flanks for efficient integration (>75% efficiency)

    • Use heterologous selectable marker cassettes conferring Hygromycin B or G418 resistance

    • Verify transformants through both phenotypic screening and genotypic confirmation

  • Phenotypic Analysis Parameters:

    • Growth profiling under various carbon sources (fermentable vs. non-fermentable)

    • Respiration measurements using oxygen electrodes

    • Mitochondrial membrane potential assessment using fluorescent probes

    • ROS production quantification

    • Stress tolerance assays (temperature, oxidative, osmotic stress)

  • Controls and Validation:

    • Include wild-type strain, complete COX3 deletion, and complemented strains as controls

    • Generate at least 3 independent mutant clones for each mutation to account for clonal variation

    • Confirm mitochondrial DNA stability before phenotypic analysis

    • Verify protein expression levels to distinguish between expression and functional defects

  • Environmental Variables:

    • Test phenotypes under multiple salt concentrations (0%, 3%, 6%, 9% NaCl)

    • Assess temperature sensitivity (20°C, 30°C, 37°C)

    • Evaluate phenotypes in both rich and minimal media

What protocols yield the highest quality mitochondrial preparations from D. hansenii for COX3 studies?

Obtaining high-quality mitochondrial preparations from D. hansenii requires specialized protocols that account for its robust cell wall and unique membrane composition. The following optimized procedure yields intact, functional mitochondria suitable for COX3 studies:

  • Cell Culture and Harvesting:

    • Grow D. hansenii in YPD medium with 3% NaCl to mid-log phase (OD600 = 1.0-1.5)

    • For respiratory chain studies, include a growth phase in glycerol-containing medium to induce mitochondrial development

    • Harvest cells by centrifugation (3,000 × g, 5 minutes, 4°C)

    • Wash twice with ice-cold water containing 1M sorbitol as osmotic stabilizer

  • Cell Wall Disruption:

    • Prepare spheroplasts using zymolyase treatment (2 mg/g wet weight) in buffer containing 1M sorbitol, 50 mM potassium phosphate (pH 7.5), and 10 mM DTT for 45-60 minutes at 30°C

    • Monitor spheroplast formation microscopically

    • Alternative method: Mechanical disruption using glass beads in a BeadBeater with 5 cycles of 30 seconds on/30 seconds off, keeping samples continuously cooled

  • Mitochondrial Isolation:

    • Disrupt spheroplasts using a Dounce homogenizer (15 strokes with a loose-fitting pestle) in isolation buffer (0.6 M sorbitol, 10 mM HEPES-KOH, pH 7.4, 1 mM EDTA, 1 mM PMSF)

    • Remove cell debris by centrifugation (2,000 × g, 5 minutes, 4°C)

    • Pellet crude mitochondria from supernatant (15,000 × g, 15 minutes, 4°C)

    • Purify mitochondria using sucrose gradient ultracentrifugation (20%-60% sucrose gradient, 134,000 × g, 1 hour, 4°C)

  • Quality Assessment:

    • Measure respiratory control ratios using oxygen consumption measurements

    • Assess membrane potential using fluorescent probes (JC-1 or TMRM)

    • Check mitochondrial purity by assaying marker enzymes (cytochrome c oxidase for mitochondria, glucose-6-phosphatase for ER contamination)

    • Verify membrane integrity using cytochrome c test

  • Storage Conditions:

    • Flash-freeze purified mitochondria in liquid nitrogen

    • Store at -80°C in small aliquots with 10% glycerol as cryoprotectant

    • Avoid repeated freeze-thaw cycles

This protocol typically yields 3-5 mg mitochondrial protein per gram wet weight of cells with respiratory control ratios >2.5, indicating well-coupled, functional mitochondria suitable for detailed COX3 studies .

How can I establish a reliable system for heterologous expression of D. hansenii COX3 for structural studies?

Establishing a reliable heterologous expression system for D. hansenii COX3 structural studies presents significant challenges due to the membrane-integrated nature of this protein. The following comprehensive approach addresses these challenges:

  • Expression System Selection:

    • For structural studies, P. pastoris (Komagataella phaffii) offers advantages including:

      • Eukaryotic protein processing capabilities

      • High-density growth in minimal media

      • Strong inducible promoters

      • Similarity to native mitochondrial environment

    • Alternative systems include specialized E. coli strains (C41/C43) with enhanced membrane protein expression capabilities, though proper folding may be compromised

  • Construct Design Elements:

    • Codon-optimize the D. hansenii COX3 sequence for the chosen expression host

    • Include purification tags (8-10× His or Twin-Strep) at either N- or C-terminus with flexible linkers

    • For crystallography studies, incorporate thermostabilizing mutations identified through alanine scanning

    • Clone under the control of tunable promoters (AOX1 for P. pastoris; T7-lac for E. coli)

  • Expression Optimization Matrix:

    ParameterVariables to TestMonitoring Method
    Temperature16°C, 20°C, 25°C, 30°CWestern blot, fluorescence
    Induction strength0.1-1.0% methanol (Pichia)SDS-PAGE, activity assay
    Induction time24h, 48h, 72hTime-course sampling
    Media supplementsHeme precursors, metal ionsAbsorption spectra
    DetergentsDDM, LMNG, GDNExtraction efficiency
  • Purification Strategy:

    • Solubilize membranes using gentle detergents (DDM at 1% w/v initially)

    • Implement two-step purification (IMAC followed by size exclusion chromatography)

    • Consider amphipol or nanodisc reconstitution for increased stability

    • Verify protein quality using thermal stability assays (CPM fluorescence)

  • Structural Analysis Approaches:

    • Cryo-EM: Preferred for membrane proteins, requires minimal sample amounts

    • X-ray crystallography: Requires extensive crystallization trials with various detergents and lipid additives

    • NMR: Limited to specific labeled domains or peptides due to size constraints

For optimal results, establish multiple parallel constructs with tags at different positions and screen extensively for expression and stability. The incorporation of GFP fusion constructs as screening tools can rapidly identify optimal expression conditions before scaling up for structural studies .

What are the most effective strategies for analyzing the interaction between D. hansenii COX3 and other respiratory chain components?

Analyzing interactions between D. hansenii COX3 and other respiratory chain components requires specialized approaches due to the hydrophobic nature of these protein complexes and the dynamic nature of their associations. The following multi-faceted strategy provides comprehensive interaction data:

  • In vivo Crosslinking Approaches:

    • Chemical crosslinking with membrane-permeable reagents (DSP, formaldehyde)

    • Photo-activatable crosslinkers incorporated through unnatural amino acid technology

    • Crosslinking followed by affinity purification and mass spectrometry (XL-MS)

  • Co-immunoprecipitation Optimization:

    • Epitope-tag COX3 with minimal tags (HA, FLAG) to reduce interference

    • Use gentle solubilization conditions (digitonin 1-2%) to maintain complex integrity

    • Include control precipitations with unrelated membrane proteins

    • Verify interactions under different growth conditions (fermentative vs. respiratory)

  • Blue Native PAGE Analysis:

    • Optimize detergent type and concentration for D. hansenii respiratory complexes

    • Use first-dimension BN-PAGE followed by second-dimension SDS-PAGE to resolve complex components

    • Implement in-gel activity staining for cytochrome c oxidase to confirm functional complexes

    • Compare complex formation in wild-type versus COX3 mutant strains

  • Proximity-based Labeling Technologies:

    • TurboID or miniTurbo fusions to COX3 for in vivo biotinylation of proximal proteins

    • APEX2 fusions for electron microscopy visualization and proximity proteomics

    • Analyze biotinylated proteins by quantitative mass spectrometry

  • Advanced Biophysical Approaches:

    • Förster Resonance Energy Transfer (FRET) using strategically placed fluorophores

    • Surface Plasmon Resonance (SPR) with reconstituted membrane proteins

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

  • Genetic Interaction Analysis:

    • Create a matrix of mutations in COX3 and potential interaction partners

    • Analyze synthetic lethality or synthetic rescue phenotypes

    • Perform suppressor screens to identify compensatory mutations

When interpreting interaction data, consider the stoichiometry of complexes, the potential for transient interactions, and the influence of lipid environment on complex stability. Integration of multiple complementary approaches provides the most robust picture of COX3's interactome within the respiratory chain .

How can I optimize D. hansenii cultivation conditions for maximum COX3 expression?

Optimizing D. hansenii cultivation conditions for maximum COX3 expression requires careful consideration of multiple growth parameters that influence mitochondrial development and respiratory chain component synthesis. The following comprehensive optimization strategy addresses key variables:

  • Carbon Source Selection and Concentration:

    • Non-fermentable carbon sources (glycerol 2-3%, ethanol 1-2%) strongly induce mitochondrial development and COX3 expression

    • Mixed carbon source strategies (0.5% glucose + 2% glycerol) can balance growth rate with expression

    • Carbon-limited continuous cultures maintain consistent respiratory metabolism

  • Salt Concentration Optimization:

    • Test NaCl gradient (0%, 3%, 6%, 9%, 12%) to identify optimal concentration for respiratory metabolism

    • Consider KCl or mixed salt environments that may better mimic natural habitats

    • Monitor both growth rate and specific COX3 expression at each salt concentration

    • Optimal salt concentration typically ranges between 3-9% NaCl, with strain-specific preferences

  • Oxygen Availability Regulation:

    • Maintain dissolved oxygen above 30% saturation using controlled aeration

    • Compare baffled versus non-baffled flasks for shake flask cultures

    • For bioreactor cultivation, implement cascade control of agitation and air flow

    • Test oxygen-enriched air for maximum respiratory chain induction

  • Media Formulation Enhancements:

    • Supplement with heme precursors (δ-aminolevulinic acid, 50-100 μM)

    • Add trace metals important for respiratory complexes (copper, iron)

    • For industrial applications, test complex by-products from dairy or pharmaceutical industries

    • Implement fed-batch strategies to control growth rate while maximizing biomass

  • Environmental Parameters:

    • Temperature: Optimal temperature typically between 25-28°C for balance of growth and expression

    • pH: Maintain between 5.5-6.5 with appropriate buffering

    • Culture age: Harvest in late exponential phase for maximum mitochondrial content

  • Stress Preconditioning:

    • Mild pretreatment with 0.1 M mannitol or sorbitol enhances stress resistance and may impact respiratory capacity

    • Short heat shock (37°C for 30 min) prior to harvest can induce protective responses

    • Controlled oxidative stress exposure may enhance mitochondrial biogenesis

For highest COX3 expression, a fed-batch cultivation approach in a controlled bioreactor with glycerol as primary carbon source, 3-6% NaCl, dissolved oxygen maintained at 50% saturation, temperature at 25°C, and pH 6.0 typically yields optimal results. Additionally, industrial by-products can serve as cost-effective cultivation media for large-scale production while maintaining high expression levels .

How can recombinant D. hansenii COX3 contribute to understanding mitochondrial disease mechanisms?

Recombinant D. hansenii COX3 offers unique insights into mitochondrial disease mechanisms due to several distinctive properties of this yeast system. D. hansenii's exceptional stress tolerance provides a robust model for investigating how respiratory chain components function under challenging conditions, potentially revealing compensatory mechanisms relevant to human disease states.

The study of recombinant D. hansenii COX3 contributes to understanding mitochondrial diseases through:

  • Comparative Functional Analysis:

    • Introducing human disease-associated COX3 mutations into D. hansenii COX3 allows functional assessment in a simplified eukaryotic system

    • The halotolerant properties of D. hansenii enable testing how osmotic stress interacts with respiratory deficiencies, potentially mimicking cellular stress conditions in disease states

    • Systematic mutation analysis can identify critical residues and domains essential for function across species

  • Drug Screening Applications:

    • D. hansenii strains expressing variant COX3 proteins can serve as screening platforms for compounds that rescue respiratory defects

    • The yeast's ability to grow in high-salt media creates a natural selection system against contamination in large-scale screening efforts

    • Compounds identified in D. hansenii screens may lead to novel therapeutic approaches for mitochondrial diseases

  • Protein-Protein Interaction Studies:

    • Recombinant expression systems allow tagging and isolation of COX3 interaction partners

    • Understanding assembly mechanisms of respiratory complexes in D. hansenii can inform human mitochondrial complex IV assembly disorders

    • Comparative interactome mapping between wild-type and disease-associated variants can reveal pathological mechanisms

  • Stress Response Integration:

    • D. hansenii's enhanced antioxidant mechanisms, including elevated catalase and superoxide dismutase activities, provide context for studying how respiratory defects impact cellular redox state

    • The integration of mitochondrial function with broader stress response pathways may reveal novel disease mechanisms

Future research should focus on developing humanized D. hansenii strains where key components of the respiratory chain are replaced with human counterparts, creating more directly relevant disease models while maintaining the experimental advantages of yeast systems .

What advances in sequencing technology have improved our understanding of D. hansenii COX3 genetic diversity?

Recent advances in sequencing technologies have substantially enhanced our understanding of genetic diversity in D. hansenii COX3 and its implications for strain evolution and adaptation. These technological improvements have enabled several key developments:

  • Long-Read Sequencing Applications:

    • Oxford Nanopore and PacBio technologies now allow complete assembly of mitochondrial genomes, including accurate representation of COX3 in its genomic context

    • Long reads enable resolution of structural variants and complex rearrangements in mitochondrial DNA that may affect COX3 expression

    • Full-length transcript sequencing reveals previously undetected splice variants and RNA editing events in mitochondrial transcripts

  • Single-Cell Sequencing Insights:

    • Single-cell approaches reveal heterogeneity in mitochondrial gene expression within populations

    • Detection of mitochondrial heteroplasmy (multiple mitochondrial genomes within a cell) provides insights into mitochondrial inheritance and segregation

    • Analysis of rare cellular subpopulations with distinct COX3 variants may explain adaptation to changing environments

  • Metagenomics and Environmental Sampling:

    • Deep sequencing of environmental samples has uncovered previously unknown D. hansenii strains with distinct COX3 variants

    • Correlation of COX3 sequence variations with ecological parameters reveals adaptation mechanisms

    • Functional metagenomics approaches identify novel COX3 variants with potentially enhanced properties

  • Comparative Genomics Applications:

    • Multi-species comparative analysis of COX3 sequences provides evolutionary context for functional domains

    • Similar to studies with other genes, COX3 sequence variation between Debaryomyces species typically ranges from 0-32.4%, with strain-specific adaptations correlating with ecological niches

    • Integration of genetic and phenotypic data across strains identifies associations between sequence variants and functional properties

  • Epigenomic Profiling:

    • Bisulfite sequencing and other epigenomic approaches reveal methylation patterns affecting mitochondrial gene expression

    • Chromatin accessibility studies of nuclear genes encoding mitochondrial regulators provide insights into coordinated expression networks

The application of these technologies has revealed that COX3 in D. hansenii exhibits greater sequence diversity than previously recognized, with variants that correlate with adaptation to specific environmental stresses. The additional variable sites in COX3 compared to other commonly used markers make it particularly valuable for strain differentiation and phylogenetic analysis . Future research should integrate these diverse data types to build comprehensive models of how COX3 genetic diversity contributes to D. hansenii's remarkable environmental adaptability.

How do mutations in D. hansenii COX3 affect cellular metabolism and stress response pathways?

Mutations in D. hansenii COX3 have profound and multifaceted effects on cellular metabolism and stress response pathways due to the central role of respiratory complex IV in energy production and reactive oxygen species management. The impacts extend beyond immediate respiratory defects to trigger complex cellular adaptations:

  • Primary Metabolic Shifts:

    • COX3 mutations typically cause reduced respiratory capacity, forcing metabolic rewiring toward fermentative pathways even in aerobic conditions

    • Altered NAD+/NADH ratios affect numerous dehydrogenase-catalyzed reactions throughout metabolism

    • Compromised proton pumping efficiency may trigger compensatory ATP generation mechanisms

    • Metabolomic profiling reveals accumulation of TCA cycle intermediates and altered lipid metabolism

  • Retrograde Signaling Activation:

    • Mitochondrial dysfunction triggers nuclear transcriptional responses (retrograde signaling)

    • Upregulation of alternative respiratory pathways and metabolic bypasses

    • Induction of mitochondrial quality control mechanisms including mitophagy

    • Enhanced expression of stress response genes including heat shock proteins

  • Oxidative Stress Management:

    • Dysfunctional cytochrome c oxidase can increase electron leakage and ROS production

    • Compensatory upregulation of antioxidant systems including catalase (CAT1) and superoxide dismutase (SOD1)

    • Altered glutathione metabolism and redox balance

    • Potential activation of oxidative stress-resistant pathways unique to D. hansenii

  • Salt Stress Integration:

    • D. hansenii's halotolerance mechanisms interact with respiratory deficiencies in complex ways

    • COX3 mutations may compromise energy-dependent ion transport systems

    • Salt stress and respiratory deficiencies may have synergistic negative effects or trigger compensatory adaptations

    • The unique osmoadaptation pathways in D. hansenii provide context-specific responses to mitochondrial dysfunction

  • Growth and Cell Cycle Effects:

    • Reduced growth rates, particularly in non-fermentable carbon sources

    • Altered cell cycle progression and potential cell cycle checkpoints activation

    • Changes in chronological and replicative lifespan

    • Modified cell morphology and potential impacts on biofilm formation

Experimental evidence indicates that pretreatment with protective compounds like mannitol (0.1 M) or sorbitol (0.1 M) can significantly enhance tolerance to oxidative and temperature stress, likely through mechanisms that also protect respiratory chain components including COX3 . This suggests potential therapeutic approaches for mitigating COX3 dysfunction through activation of protective cellular pathways rather than direct targeting of the affected protein.

What bioinformatics tools are most valuable for analyzing D. hansenii COX3 structure-function relationships?

A comprehensive bioinformatics toolkit is essential for analyzing structure-function relationships in D. hansenii COX3. The following specialized tools and approaches provide valuable insights at different levels of analysis:

  • Sequence Analysis and Evolution:

    • MEGA X: For phylogenetic analysis of COX3 sequences across fungal species

    • ConSurf: Identifies functionally important residues based on evolutionary conservation

    • Codon-based Z-tests: Detects signature of selection on specific codons

    • PAML: Evaluates evolutionary models and detects positive selection

    • HHpred: Sensitive homology detection through HMM-HMM comparison

  • Structural Prediction and Analysis:

    • AlphaFold2/RoseTTAFold: Deep learning-based 3D structure prediction, particularly valuable for membrane proteins

    • HMMTOP/TMHMM: Transmembrane topology prediction

    • SWISS-MODEL: Homology modeling based on related structures

    • HOLE: Analysis of channels and pores within the protein structure

    • MDAnalysis: Python library for analyzing molecular dynamics simulations

    • PyMOL/ChimeraX: Visualization and analysis of protein structures

  • Functional Site Prediction:

    • 3DLigandSite: Prediction of ligand binding sites

    • PROPKA: pKa prediction and protonation state analysis

    • APBS: Electrostatic analysis for proton transfer pathways

    • SiteMap: Identification and scoring of potential functional sites

    • FTMap: Mapping of protein binding hot spots

  • Systems-Level Analysis:

    • STRING: Protein-protein interaction network analysis

    • KEGG Pathway: Contextualizing COX3 within respiratory chain pathways

    • Cytoscape: Network visualization and analysis

    • BiGG Models: Genome-scale metabolic modeling to predict effects of COX3 mutations

    • GEO: Mining expression data for co-regulation patterns

  • Mutation Analysis Tools:

    • PROVEAN/SIFT: Predicting functional effects of amino acid substitutions

    • DynaMut: Analyzing mutation effects on protein dynamics

    • mCSM-membrane: Specialized stability prediction for membrane protein mutations

    • MutPred: Prediction of molecular mechanisms underlying disease-associated mutations

  • Specialized Membrane Protein Tools:

    • OPM: Optimal positioning of protein structures in membranes

    • MOLE: Analysis of channels and pores in membrane proteins

    • PPM server: Membrane positioning prediction

    • CHARMM-GUI Membrane Builder: Preparation of membrane protein systems for MD simulations

For integrative analysis, a workflow combining sequence-based approaches with structural prediction and systems-level analysis provides the most comprehensive insights. Begin with multiple sequence alignments to identify conserved regions, use AlphaFold2 for structural prediction, validate transmembrane topology, and then analyze specific sites of interest using specialized tools. Connecting structural features to experimental phenotypes of mutations provides the strongest evidence for structure-function relationships .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.