Recombinant Debaryomyces hansenii Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant FCJ1 is expressed in heterologous systems such as E. coli, yeast (Pichia pastoris), or mammalian cells. Key production parameters include:

Table 2: Recombinant FCJ1 Expression Systems

Host SystemPurityTagProtein LengthSource
E. coli≥90%N-terminal HisFull-length (29–578 aa)
Yeast≥85%NonePartial sequences
Mammalian Cells≥85%CustomizablePartial sequences
  • Storage: Lyophilized powder stable at -80°C; reconstituted in Tris/PBS buffer with 50% glycerol for long-term storage .

  • Sequence Validation: Confirmed via SDS-PAGE and mass spectrometry .

Role in Cristae Morphogenesis

FCJ1 overexpression in Saccharomyces cerevisiae increases CJ density and cristae branching, while its deletion leads to concentric inner membrane stacks and impaired oxidative phosphorylation . Genetic interactions with F1Fo ATP synthase subunits (Su e and Su g) suggest antagonistic roles in modulating ATP synthase oligomerization, which directly influences cristae curvature .

Interaction with the TOB/SAM Complex

The C-terminal domain of FCJ1 binds to Tob55, a β-barrel assembly protein in the outer membrane. This interaction positions CJs near mitochondrial contact sites, ensuring efficient metabolite exchange . Downregulation of TOB/SAM reduces CJ stability, highlighting the interdependence of these complexes .

Table 3: Key Functional Mutants and Phenotypes

MutationPhenotypeImpact on CJs
ΔC-terminalLoss of CJs; irregular cristae stacksSevere cristae disassembly
FCJ1 overexpressionEnlarged CJ diameter; cristae branchingHyperactive CJ formation

Applications in Biotechnology

Recombinant FCJ1 is utilized to study mitochondrial dynamics and diseases linked to cristae dysfunction (e.g., neurodegenerative disorders). Its role in stabilizing respiratory supercomplexes makes it a target for metabolic engineering in Debaryomyces hansenii, a yeast species optimized for high-salt industrial byproduct utilization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MIC60; DEHA2B01716g; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-578
Protein Length
Full Length of Mature Protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
MIC60
Target Protein Sequence
NVPNNQRTPPPAVRPPTSPIIVTEGGPKGGSQKQKKKFSFAGFLFKTAFWASVVYGGTLF VATKNDKVMDFIMDKQPPYYEELLNVIEHGSIEDLKRQLRDTQHKISNFDFKLPSKAKID EFTHELESRGENLIEETKRKLGTSTGAKPRQAIPEGNSAPTPAEQLQKPVETIHKTVDHL PLIQLDKGIASSVDSSIKSTIKSFNDLILSIDAGSQSGNESLMREITENVSKLSSKLNKL TSSFDEELSSKLKISQSELLSSYTKKELELTENLLHQFHHEKAQMEKKLGSRLDQEIEAT KQTISQAAVNAVSMMRVEQTKNFEKLIKGKIDQERDGRLANLDKLNSRITELENFSTSLE SQLVANHQKSLIQQSLTKLKSLLLGASSEQEKPRLISPYVDNLAKVSHESKDELIALALQ DLQPLLSRESTQSILSTPQLLTRWEQLVPELRSASLLPPNAGLLGHLSSMLFSKLLFPVK GAKPDGKDIESVIGRVESSLARGELDVAVEEAANLKGWSRKLADDWVKEGRKKLEIEFLM KIIDAESKIL
Uniprot No.

Target Background

Function
FCJ1 (Formation of crista junctions protein 1) is a component of the MICOS complex, a large protein complex within the mitochondrial inner membrane. This complex plays crucial roles in maintaining crista junctions, preserving inner membrane architecture, and establishing contact sites with the outer membrane. FCJ1 contributes to maintaining the connection between cristae membranes and the inner boundary membrane. Furthermore, it promotes protein import through the mitochondrial intermembrane space assembly (MIA) pathway.
Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is FCJ1 and what is its primary function in mitochondria?

FCJ1 (Formation of Crista Junctions protein 1) is a mitochondrial inner membrane protein that plays a crucial role in the formation and maintenance of crista junctions. These junctions are tubular or slot-like structures that connect the inner boundary membrane with the cristae membrane in mitochondria . FCJ1 is specifically enriched at these junction sites, making it a key architectural element for proper mitochondrial function . In the absence of FCJ1, mitochondria display severe ultrastructural abnormalities, particularly the absence of crista junctions and the formation of concentric stacks of inner membrane within the mitochondrial matrix .

How does FCJ1 differ between Debaryomyces hansenii and Saccharomyces cerevisiae?

While both organisms possess FCJ1 proteins with similar functions, the research indicates that FCJ1 was first characterized in detail in S. cerevisiae as a protein specifically enriched at crista junctions . The D. hansenii version maintains the core functional domains, including a conserved C-terminal domain that is essential for FCJ1 function . The full-length mature D. hansenii FCJ1 protein spans amino acids 29-578 and contains structural elements similar to those found in S. cerevisiae, including regions predicted to form coiled-coil structures . Both proteins function to antagonize F1F0-ATP synthase oligomerization, thereby modulating cristae morphology, though species-specific differences in regulation may exist.

How can recombinant D. hansenii FCJ1 be expressed and purified for in vitro studies?

For in vitro studies, recombinant D. hansenii FCJ1 can be expressed in E. coli systems with affinity tags for purification. According to available information, the mature protein (amino acids 29-578) can be expressed with an N-terminal His-tag . The purification typically involves:

  • Bacterial expression optimization (typically using BL21 or similar strains)

  • Cell lysis under conditions that maintain protein stability

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Additional purification steps such as size exclusion chromatography

  • Quality assessment by SDS-PAGE (aiming for >90% purity)

  • Proper storage as a lyophilized powder to maintain stability

When designing expression constructs, special attention should be paid to the transmembrane domain and the C-terminal region, as these are crucial for FCJ1 function .

What methods are most effective for studying FCJ1 localization in mitochondria?

For studying FCJ1 localization within mitochondria, several complementary approaches have proven effective:

  • Immunogold electron microscopy: This technique provides the highest resolution for determining the precise localization of FCJ1 at crista junctions. Previous studies have successfully used this approach to show specific enrichment of FCJ1 at CJs while other proteins like F1F0-ATP synthase subunits are preferentially located at cristae tips .

  • Fluorescence microscopy with GFP fusion proteins: For dynamic studies, FCJ1 can be tagged with fluorescent proteins, though care must be taken to ensure the tag doesn't disrupt function.

  • Subcellular fractionation and Western blotting: This approach can confirm mitochondrial localization but lacks the resolution to distinguish different submitochondrial compartments.

  • Protease protection assays: These can help determine the topology of FCJ1 within the inner membrane.

The combination of these techniques provides comprehensive information about FCJ1's submitochondrial localization and its relationship to other mitochondrial structures .

What are the critical controls when performing heterologous expression studies with FCJ1?

When performing heterologous expression studies with FCJ1, several critical controls must be included:

  • Expression level verification: Confirm that the recombinant protein is expressed at levels comparable to endogenous FCJ1 to avoid artifacts due to overexpression.

  • Functional complementation: In deletion backgrounds (Δfcj1), verify that the heterologously expressed protein restores normal mitochondrial morphology and function.

  • Domain integrity verification: For studies involving FCJ1 domains, controls should include full-length FCJ1 and domain-deletion variants to compare functional outcomes.

  • Localization confirmation: Verify proper submitochondrial localization of the expressed protein, particularly enrichment at crista junctions.

  • Background strain controls: As shown in studies with S. cerevisiae, the genetic background can influence results, so appropriate wild-type and deletion strains should be included as controls .

For example, research has shown that expression of FCJ1 variants lacking the coiled-coil domain in a Δfcj1 background failed to restore normal crista junction formation, with junction numbers reduced to ~4% of control levels .

What is the role of the C-terminal domain of FCJ1?

The C-terminal domain of FCJ1 is the most conserved part of the protein and is essential for its function in crista junction formation . Research has demonstrated several key roles for this domain:

  • Oligomer formation: The C-terminal domain interacts with full-length FCJ1, suggesting it plays a crucial role in the formation of FCJ1 oligomers that may be necessary for proper function .

  • Protein-protein interactions: This domain mediates interaction with other mitochondrial proteins, including Tob55 of the translocase of outer membrane β-barrel proteins (TOB)/sorting and assembly machinery (SAM) complex .

  • CJ formation: Deletion of the C-terminal domain severely impairs crista junction formation. Experiments have shown that expression of FCJ1 lacking this domain (FCJ1 1-472) in Δfcj1 cells results in a dramatic reduction of CJs to only ~9% of control levels .

  • Mitochondrial ultrastructure: In the absence of the C-terminal domain, mitochondria develop irregular, stacked cristae similar to the phenotype observed in complete FCJ1 deletion .

These findings highlight the C-terminal domain as a critical functional element in FCJ1-mediated crista junction architecture.

How does the transmembrane domain of FCJ1 contribute to its function?

The transmembrane domain of FCJ1 plays an important role in anchoring the protein to the inner mitochondrial membrane, but interestingly, its specific sequence appears less critical than its presence. Research has revealed:

  • Membrane anchoring: The transmembrane domain ensures proper localization of FCJ1 to the inner mitochondrial membrane, positioning it correctly for crista junction formation.

  • Sequence flexibility: Studies replacing the native transmembrane domain with that from other proteins (e.g., Dld1-TM) showed no significant alteration in function, suggesting the primary role is membrane anchoring rather than sequence-specific interactions .

  • Processing and import: The transmembrane region may influence the import and processing of FCJ1 in the mitochondria. For instance, when the native transmembrane segment was replaced with the Cytochrome b2 presequence (Fcj1 Cyt b2), some functional impairment was observed with a reduction in CJs to ~46% compared to wild-type .

  • G52L mutation analysis: A G52L mutation within the transmembrane domain did not significantly affect FCJ1 function, with CJ numbers reaching 124% of control levels, further supporting the idea that specific amino acid sequence is not critical .

These findings indicate that while the transmembrane domain is necessary for proper FCJ1 function, there is considerable flexibility in its sequence requirements.

What is known about the coiled-coil domain of FCJ1 and its functional significance?

The coiled-coil domain of FCJ1 is essential for the protein's function in forming and maintaining crista junctions . Key insights include:

  • Structural role: The coiled-coil domain (approximately residues 166-342 in S. cerevisiae FCJ1) forms α-helical structures that likely mediate protein-protein interactions crucial for CJ formation.

  • CJ formation: Deletion of the coiled-coil domain (Fcj1 Δ166-342His) dramatically reduces the number of crista junctions to approximately 4% of control levels, demonstrating its critical importance .

  • Mitochondrial morphology: Cells expressing FCJ1 lacking the coiled-coil domain display severe ultrastructural defects, including concentric cristae stacks similar to those seen in complete FCJ1 deletion .

  • Protein complex formation: The coiled-coil domain may be involved in the interaction of FCJ1 with other components of the MICOS/MINOS/MitOS complex, which collectively regulates cristae morphology .

The severe phenotype associated with coiled-coil domain deletion underscores its fundamental importance in FCJ1 function, potentially through mediating critical protein-protein interactions necessary for proper crista junction architecture.

How does FCJ1 interact with the F1F0-ATP synthase to regulate cristae morphology?

FCJ1 and the F1F0-ATP synthase function antagonistically to regulate cristae morphology through a complex interplay that affects membrane curvature . Research has revealed:

  • Opposing localization patterns: FCJ1 is enriched at crista junctions, while F1F0-ATP synthase components (particularly subunits e and g) are concentrated at cristae tips, creating spatial separation of these opposing functions .

  • Regulation of F1F0 oligomerization: FCJ1 appears to negatively regulate the formation of F1F0-ATP synthase supercomplexes. Cells lacking FCJ1 show increased levels of F1F0 supercomplexes, while FCJ1 overexpression reduces these levels .

  • Membrane curvature effects: The oligomeric state of F1F0-ATP synthase influences membrane curvature, with oligomers promoting the highly curved membranes found at cristae tips. FCJ1 counteracts this effect, promoting the distinct membrane architecture at crista junctions .

  • Genetic interaction: There is genetic interaction between FCJ1 and subunits e and g of F1F0-ATP synthase. Deletion of subunits e and g causes enlargement of CJ diameter and promotes cristae branching, suggesting a balanced antagonism between these components .

This antagonistic relationship represents a sophisticated regulatory mechanism that locally modulates membrane curvature to create the distinct architectural elements of the mitochondrial inner membrane.

What is the relationship between FCJ1 and the MICOS/MINOS/MitOS complex?

FCJ1 has been identified as a component of a larger multisubunit complex called MICOS (mitochondrial contact site and cristae organizing system), also known as MINOS or MitOS . This relationship reveals:

  • Complex composition: FCJ1 functions as part of this larger complex that includes multiple proteins involved in determining cristae morphology and crista junction formation.

  • Functional integration: Within this complex, FCJ1 plays a central role in CJ formation, while other components may have complementary or specialized functions. For instance, another component, Aim13/Mcs19, influences CJ numbers but may not affect cellular growth rates when deleted .

  • Evolutionary conservation: The MICOS/MINOS/MitOS complex components are conserved across species, suggesting fundamental importance in mitochondrial structure and function.

  • Coordination of membrane contacts: Beyond crista junction formation, this complex may coordinate contacts between the inner and outer mitochondrial membranes, as suggested by FCJ1's interaction with the TOB/SAM complex of the outer membrane .

Understanding FCJ1's role within this larger complex provides insight into the integrated mechanisms controlling mitochondrial membrane architecture.

What phenotypes are observed when different domains of FCJ1 are deleted or modified?

Various FCJ1 domain modifications produce distinct phenotypes, revealing the functional contributions of each domain :

FCJ1 VariantDescriptionCJs (% of control)Phenotype
FCJ1 DLD1-TMTransmembrane domain replaced68%Normal mitochondrial morphology
FCJ1 G52LPoint mutation in transmembrane domain124%Normal morphology, slightly increased CJs
FCJ1 Cyt b2TM replaced with Cyt b2 presequence46%Reduced CJs, partially altered morphology
FCJ1 Δ166-342HisCoiled-coil domain deleted4%Severe reduction in CJs, concentric cristae stacks
FCJ1 1-472C-terminal domain deleted9%Severe reduction in CJs, abnormal cristae structure

These data demonstrate that:

  • The coiled-coil and C-terminal domains are essential for FCJ1 function, with their deletion causing severe reduction in crista junctions.

  • The transmembrane domain is necessary but shows flexibility in sequence requirements, as replacements with other TM domains maintain substantial functionality.

  • The G52L mutation in the transmembrane domain does not impair function and may even enhance CJ formation slightly.

  • The processing and import of FCJ1 may be affected by alterations to the N-terminal regions, as seen with the Cyt b2 presequence replacement .

These insights provide a detailed understanding of domain-specific contributions to FCJ1 function.

How does D. hansenii FCJ1 compare to mitofilin and other FCJ1 orthologues in different species?

D. hansenii FCJ1 belongs to a family of evolutionarily conserved proteins that includes mitofilin in mammals and FCJ1 in other yeasts . Comparative analysis reveals:

  • Conserved domains: The C-terminal domain is the most highly conserved region across species, underscoring its fundamental importance in protein function .

  • Functional conservation: Across species, these proteins share the core function of promoting crista junction formation. The mammalian orthologue mitofilin/IMMT is also required for proper cristae morphology .

  • Organizational context: While D. hansenii and S. cerevisiae FCJ1 function similarly, the broader organizational context may differ between species. For instance, the composition and regulation of the MICOS/MINOS/MitOS complex can vary between organisms.

  • Evolutionary divergence: Despite functional conservation, there are species-specific adaptations in sequence and regulation that may reflect differing metabolic requirements or mitochondrial functions across species.

The conservation of this protein family from yeast to mammals highlights the fundamental importance of proper cristae architecture for mitochondrial function throughout eukaryotic evolution.

What is the relationship between carboxylate transporters and mitochondrial structure in D. hansenii?

  • Metabolic integration: Carboxylate transporters facilitate the uptake of organic acids like lactate, acetate, succinate, and malate that can be utilized in mitochondrial metabolism . The proper structure of mitochondria, maintained by FCJ1, is essential for optimal energy production from these substrates.

  • Functional compartmentalization: The organization of cristae and crista junctions influenced by FCJ1 affects the compartmentalization of metabolic processes within mitochondria. This organization may impact the efficiency of substrate utilization after transport by Jen1 family transporters.

  • Evolutionary adaptation: D. hansenii is known for its tolerance to high salt concentrations and ability to utilize various carbon sources. The presence of both specialized carboxylate transporters and mechanisms for maintaining optimal mitochondrial structure may represent complementary adaptations for metabolic flexibility.

  • Research opportunity: The potential functional relationship between carboxylate transport and mitochondrial architecture represents an interesting area for future research, particularly in understanding how D. hansenii adapts to different nutritional environments.

While direct evidence for interaction is not provided in the research, the metabolic connection between substrate transport and mitochondrial energy production suggests potential functional integration.

How might understanding FCJ1 function contribute to broader research on mitochondrial diseases?

Research on FCJ1 and crista junction architecture has significant implications for understanding mitochondrial diseases :

  • Structural basis of dysfunction: Many mitochondrial diseases involve alterations in cristae morphology. Understanding how FCJ1 and related proteins maintain proper architecture provides insight into the structural basis of mitochondrial dysfunction in disease states.

  • Apoptotic regulation: Remodeling of crista junctions occurs during apoptosis, and proteins related to FCJ1, such as OPA1 in mammals, are involved in this process . This connection highlights the importance of crista junction dynamics in cell death pathways relevant to numerous diseases.

  • Therapeutic targeting: The identification of specific proteins and domains critical for maintaining mitochondrial architecture, such as the C-terminal domain of FCJ1, provides potential targets for therapeutic interventions aimed at preserving or restoring normal mitochondrial structure in disease states.

  • Biomedical model systems: Studies in model organisms like D. hansenii and S. cerevisiae provide experimentally tractable systems for understanding the fundamental principles of mitochondrial architecture that can be translated to more complex mammalian systems.

  • Metabolic disease connections: Given the essential role of mitochondria in energy production, insights into the structural requirements for optimal mitochondrial function may enhance our understanding of metabolic diseases such as diabetes and obesity.

The fundamental nature of cristae architecture in mitochondrial function makes FCJ1 research relevant to a broad spectrum of mitochondrial-related diseases and aging processes.

What are the most effective techniques for visualizing crista junctions in yeast models?

Several complementary techniques have proven effective for studying crista junctions in yeast models:

  • Electron microscopy of serial sections: This classical approach allows visualization of the three-dimensional organization of mitochondria, revealing the connection between cristae and the inner boundary membrane through crista junctions .

  • Electron tomography: This advanced technique provides three-dimensional reconstruction of mitochondrial ultrastructure at high resolution, allowing precise measurement of crista junction dimensions (typically 12-40 nm in diameter) and detailed analysis of their morphology .

  • Immunogold electron microscopy: By combining ultrastructural analysis with specific protein localization, this technique has been crucial for demonstrating the enrichment of FCJ1 at crista junctions and the differential distribution of other proteins like F1F0-ATP synthase components .

  • Chemical fixation and cryosectioning: These preparative techniques have been successfully used to preserve mitochondrial ultrastructure for analysis of crista junction numbers and morphology in different FCJ1 variants .

For quantitative assessment, researchers typically count the number of crista junctions per mitochondrial section, as demonstrated in studies comparing different FCJ1 variants .

How can researchers quantitatively assess changes in cristae morphology?

Quantitative assessment of cristae morphology involves several complementary approaches:

  • Crista junction counting: The number of crista junctions per mitochondrial section provides a direct measure of FCJ1 function. This approach has been used to demonstrate that deletion of the coiled-coil or C-terminal domains reduces CJ numbers to 4% and 9% of control levels, respectively .

  • Measurement of CJ dimensions: Electron tomography allows precise measurement of crista junction diameter. Changes in diameter can indicate altered regulation, as seen when F1F0 oligomer formation is impaired by deletion of subunits e/g, resulting in enlarged CJ diameter .

  • Analysis of cristae branching: The degree of cristae branching can be quantified and serves as an indicator of altered membrane architecture. Overexpression of FCJ1 increases cristae branching, while deletion of F1F0 subunits e/g also promotes this phenotype .

  • Assessment of cristae tip numbers: Quantification of cristae tips provides insight into the balance between FCJ1 and F1F0-ATP synthase activities. Impairment of F1F0 oligomer formation reduces cristae tip numbers .

  • Biochemical assessment of protein complexes: Blue native gel electrophoresis can be used to analyze the oligomeric state of the F1F0-ATP synthase, which correlates with cristae morphology and is regulated by FCJ1 .

These quantitative approaches provide objective measures of the impact of genetic manipulations on mitochondrial ultrastructure.

What genetic tools are available for studying FCJ1 function in D. hansenii compared to S. cerevisiae?

While S. cerevisiae has been the primary model for detailed genetic analysis of FCJ1 function, several approaches can be applied to study FCJ1 in D. hansenii:

  • Heterologous expression: D. hansenii FCJ1 can be expressed in S. cerevisiae fcj1Δ strains to assess functional conservation and domain-specific functions, similar to approaches used for analyzing Jen1 family transporters .

  • Expression constructs: The availability of recombinant D. hansenii FCJ1 protein expression systems facilitates the production of domain-specific variants for functional studies .

  • Comparative genomic analysis: The identification of D. hansenii FCJ1 as an orthologue of S. cerevisiae FCJ1 and mammalian mitofilin enables sequence-based prediction of functional domains that can guide targeted genetic studies .

  • Adaptation of S. cerevisiae tools: The genetic tractability of S. cerevisiae has enabled detailed analysis of FCJ1 domains and interactions. Many of these approaches, including:

    • Domain deletion analysis

    • Site-directed mutagenesis

    • Protein-protein interaction studies

    • Subcellular localization analysis
      can be adapted for D. hansenii with appropriate modifications to account for species-specific differences in genetic manipulation techniques.

While D. hansenii presents some additional challenges for genetic manipulation compared to S. cerevisiae, the conservation of FCJ1 function across species enables comparative approaches that leverage the extensive toolkit developed in model organisms.

What unresolved questions remain about FCJ1 function and regulation?

Despite significant advances in understanding FCJ1, several important questions remain unresolved:

  • Regulatory mechanisms: How is FCJ1 expression and localization regulated in response to metabolic conditions or stress? The observation that DHJEN genes in D. hansenii are expressed across various carbon sources (lactate, succinate, citrate, glycerol, and glucose) suggests complex regulation that warrants further investigation .

  • Protein-protein interaction network: While FCJ1 interacts with components of the MICOS/MINOS/MitOS complex and the TOB/SAM complex, the complete interaction network and how these interactions are dynamically regulated remains to be fully characterized .

  • Structural details: The precise structural basis for FCJ1's role in determining membrane curvature at crista junctions remains unclear. High-resolution structural studies could provide insight into this fundamental aspect of FCJ1 function.

  • Species-specific adaptations: The functional significance of species-specific variations in FCJ1 sequence and regulation between D. hansenii and other organisms remains largely unexplored.

  • Integration with metabolism: How changes in mitochondrial architecture mediated by FCJ1 affect metabolic functions, particularly in relation to the utilization of substrates transported by carboxylate transporters in D. hansenii, represents an interesting area for future research .

  • Physiological significance: While the structural impact of FCJ1 deletion or modification is clear, the full physiological consequences and their mechanistic basis require further investigation.

Addressing these questions will enhance our understanding of how mitochondrial architecture is integrated with function across different conditions and species.

How might advances in cryo-electron microscopy impact future studies of FCJ1 and crista junctions?

Advances in cryo-electron microscopy (cryo-EM) offer transformative potential for FCJ1 research:

  • Structural determination: Cryo-EM could enable determination of the three-dimensional structure of FCJ1 and its domains at near-atomic resolution, providing insight into how this protein mediates membrane curvature at crista junctions.

  • In situ visualization: Cryo-electron tomography allows visualization of macromolecular complexes within their native cellular environment, potentially revealing how FCJ1 organizes within the mitochondrial membrane to form crista junctions.

  • Protein complex architecture: The organization of FCJ1 within the MICOS/MINOS/MitOS complex could be visualized using cryo-EM, providing insight into how multiple proteins collaborate to maintain mitochondrial architecture.

  • Dynamic structural transitions: Time-resolved cryo-EM approaches could potentially capture different states of crista junction formation or remodeling, providing insight into the dynamic aspects of FCJ1 function.

  • Higher resolution of membrane curvature: Improved resolution of membrane structures could reveal how FCJ1 and F1F0-ATP synthase create the distinct curvatures found at crista junctions and cristae tips, respectively.

These advances would complement existing biochemical and genetic approaches to provide a more comprehensive understanding of FCJ1 function at the molecular level.

What potential biotechnological applications might emerge from understanding FCJ1 function?

Understanding FCJ1 function could lead to several biotechnological applications:

These potential applications highlight the broader impact of fundamental research on mitochondrial architecture proteins like FCJ1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.