TVP23 is a transmembrane protein localized to the Golgi apparatus, an essential organelle responsible for protein processing, modification, and trafficking in eukaryotic cells. The Debaryomyces hansenii TVP23 protein belongs to a highly conserved family of membrane proteins found across fungal species from yeast to filamentous fungi, with homologs also present in higher eukaryotes including humans . This conservation across evolutionary distances suggests essential cellular functions that have been maintained throughout eukaryotic evolution.
The protein was initially characterized alongside other novel membrane proteins (Tvp38, Tvp18, and Tvp15) in Saccharomyces cerevisiae through proteomic analysis of immunoisolated Golgi subcompartments . These proteins were found to mainly localize in Tlg2-containing compartments, suggesting roles in late Golgi/endosomal trafficking systems.
The recombinant Debaryomyces hansenii TVP23 protein consists of 227 amino acids spanning the full length of the native protein. The protein's amino acid sequence is:
MNSAYTAIESDVPEQAQQPSAQSNATSAGANVSPSEWTWSQKLKESSHPIALLFYIFFRV SPLFIYLFGTLLIGIITKKNKFILHFIIIVLLVSGDFWNLKNIAGRLLVGLRWWNEVSVI KSTNGEFENVWVFETVDPNRYINPIDSKVFWTLLYVQPAAWVVLGFLALLKFEFLYLLLI IISISLSLTNAMAFTKCDKFGKANHLATDIFSRATGNLFSRLNPFST
Analysis of this sequence reveals multiple hydrophobic regions consistent with a multi-pass transmembrane protein architecture, which aligns with its function as a Golgi membrane protein. The Debaryomyces hansenii TVP23 is cataloged in protein databases with the UniProt ID Q6BVH1 and has synonyms including DEHA2C02728g .
For optimal use in experimental settings, the manufacturer recommends reconstituting the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol (5-50% final concentration) is recommended for long-term storage, with 50% being the default recommendation . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to maintain protein quality and activity.
While the specific functions of Debaryomyces hansenii TVP23 have not been extensively characterized, insights from homologous proteins in other organisms provide valuable information. In Saccharomyces cerevisiae, TVP23 is non-essential for growth under laboratory conditions but plays roles in the maintenance and function of late Golgi/endosomal compartments .
The yeast homolog of TVP23 exists in an interactive network with Yip1-family proteins, specifically Yip4 and Yip5, which collectively assist in maintaining Golgi/endosomal compartment integrity and function . Genetic studies have shown that disruption of tvp23 exhibits synthetic aggravation when combined with ypt6 or ric1 null mutations, suggesting potential functional redundancy or cooperative roles with these proteins in vesicular trafficking .
The mammalian homolog TVP23B provides additional insights into the potential functions of this protein family. TVP23B has been identified as crucial for intestinal homeostasis, controlling the function of specialized secretory cells including Paneth cells and goblet cells . This suggests a conserved role for TVP23 family proteins in regulating secretory pathways across eukaryotes.
TVP23B binds with another Golgi protein, YIPF6, and deficiency in either protein leads to common deficiencies in several critical glycosylation enzymes in the Golgi apparatus . This indicates that TVP23 family proteins may be involved in maintaining proper enzyme composition within the Golgi, potentially affecting protein glycosylation and subsequent secretion.
Studies of yeast TVP23 suggest potential RNA interactions. Prediction analyses indicate possible interactions with various RNAs, including those encoded by genes such as YML009W-B, NOP1, and NSR1, although these interactions have moderate prediction scores . These potential interactions require further validation but suggest possible roles in RNA biology or regulation.
The TVP23 protein family shows considerable conservation across species while maintaining species-specific features. For comparison, the Laccaria bicolor TVP23 homolog consists of 266 amino acids and shows some sequence similarity to D. hansenii TVP23 . The amino acid sequences of TVP23 proteins from different species reflect both conserved functional domains and species-specific adaptations.
The conservation of TVP23 across diverse fungal species, including both unicellular yeasts like D. hansenii and filamentous fungi like L. bicolor, highlights the evolutionary importance of this protein family. These proteins appear to have maintained similar subcellular localization and general functions while potentially adapting to species-specific requirements of Golgi organization and trafficking.
Recombinant D. hansenii TVP23 serves as a valuable research tool for studying:
Golgi membrane protein structure and dynamics
Protein trafficking pathways in eukaryotic cells
Comparative analysis of Golgi organization across fungal species
Development of specific antibodies for protein detection and localization studies
The availability of purified recombinant protein facilitates biochemical and structural studies that were previously challenging with membrane proteins. This enables detailed characterization of protein-protein interactions and potential post-translational modifications that may regulate TVP23 function.
Understanding Golgi membrane proteins like TVP23 has potential applications in biotechnology, particularly in:
Engineering improved protein secretion pathways in yeast expression systems
Developing novel antifungal targets, given the importance of the Golgi apparatus in fungal cell biology
Optimization of heterologous protein production in industrial strains of yeast
Biomedical research into disorders related to Golgi trafficking defects
KEGG: dha:DEHA2C02728g
TVP23 belongs to a protein family that is highly conserved across fungal species and has homologs in higher eukaryotes. In mammals, the homologous protein TVP23B has been shown to regulate host-microbe interactions in the intestine by controlling the homeostasis of Paneth cells and the function of goblet cells . This results in the regulation of antimicrobial peptides and affects the integrity of the mucus layer .
In yeast model systems, the TVP23 family proteins interact with other Golgi proteins such as YIPF6, which is critical for intestinal homeostasis . The Golgi proteomes of cells deficient in these proteins show common deficiencies in several critical glycosylation enzymes, suggesting a conserved role in glycosylation processes across species .
Expression Protocol:
Clone the TVP23 gene into a suitable expression vector with an N-terminal His tag
Transform into E. coli expression strain (BL21(DE3) or similar)
Induce expression with IPTG at reduced temperature (16-20°C) to enhance proper folding
Harvest cells and disrupt by sonication or French press
Solubilize membrane fraction with appropriate detergents (e.g., DDM, CHAPS)
Purification Strategy:
Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Apply a detergent-containing buffer to maintain protein solubility
Elute with imidazole gradient
Conduct size exclusion chromatography for further purification
Storage Recommendations:
Store the purified protein at -20°C/-80°C with 5-50% glycerol added to prevent freeze damage . Avoid repeated freeze-thaw cycles and consider storing working aliquots at 4°C for up to one week .
Recent advances have made gene targeting in D. hansenii more accessible and efficient. A PCR-based method allows for gene targeting at high efficiency (>75%) in wild-type isolates without requiring auxotrophic markers .
PCR-based gene targeting protocol:
Design primers with 50 bp flanks homologous to regions surrounding the TVP23 gene
Amplify a heterologous selectable marker (hygromycin B or G418 resistance cassettes)
Transform D. hansenii cells with the PCR product
Select transformants on appropriate antibiotic-containing media
For expression of modified versions of TVP23, researchers can use a "safe harbor" integration site in the genome, which has been demonstrated as an effective approach for heterologous protein expression in D. hansenii .
Interaction Studies:
Perform co-immunoprecipitation experiments to identify TVP23 binding partners
Use yeast two-hybrid or BioID proximity labeling to map the interactome
Analyze interactions with other Golgi proteins, particularly YIPF6, which has been shown to interact with TVP23 homologs
Functional Assays:
Assess Golgi morphology in TVP23 knockout or overexpression strains using fluorescence microscopy
Evaluate protein glycosylation patterns using lectin blotting or mass spectrometry
Measure secretion efficiency of model proteins
Analyze lipid composition of Golgi membranes
Cellular Stress Response:
D. hansenii is known for its osmotolerance and stress tolerance characteristics . Researchers can investigate how TVP23 contributes to these properties by:
Comparing growth of wild-type and TVP23-deficient strains under various stress conditions
Measuring stress response pathway activation
Assessing changes in membrane composition and integrity
D. hansenii strains exhibit diverse properties that could extend to variations in TVP23 function . Studies have shown that different isolates respond differently to genetic manipulations, with some showing unexpected phenotypic effects .
Comparative analysis approach:
Sequence TVP23 genes from multiple D. hansenii strains to identify polymorphisms
Generate TVP23 knockouts in diverse strain backgrounds
Perform complementation studies with TVP23 variants
Compare phenotypes across strains under various conditions
One study noted that in certain D. hansenii isolates, gene disruption attempts resulted in the presence of both disrupted and wild-type gene copies, suggesting genomic peculiarities that researchers should account for in experimental design .
When obtaining or sharing D. hansenii strains or TVP23 constructs, researchers should carefully consider material transfer agreement (MTA) terms to preserve academic freedom and future research opportunities .
Key MTA considerations:
Avoid terms that restrict publication rights or impose excessive publication delays
Be cautious of clauses asserting extensive ownership rights in research results
Watch for inappropriate indemnification requirements
Identify potential conflicts with other funding sources or material obligations
Consider the impact on student researchers whose careers may depend on unrestricted use of research results
For NIH-funded research in the U.S., follow the NIH Research Tools Policy, which encourages broad dissemination of research tools with minimal encumbrances .
Structural Validation:
Circular dichroism (CD) spectroscopy to assess secondary structure content
Limited proteolysis to evaluate folding quality
Size exclusion chromatography to confirm monodispersity
Functional Validation:
Liposome binding or reconstitution assays to confirm membrane association
In vitro interaction studies with known binding partners
Complementation assays in TVP23-deficient strains
Localization studies using fluorescently-tagged TVP23 to confirm Golgi targeting
Activity Assays:
Based on homology to TVP23B, which affects glycosylation enzymes in the Golgi , researchers could:
Test whether recombinant TVP23 affects glycosyltransferase activity in vitro
Evaluate its ability to restore normal glycosylation patterns in TVP23-depleted cells
Assess its capacity to bind or modify relevant Golgi lipids
D. hansenii is recognized for its exceptional osmotolerance, stress tolerance, and oleaginous nature, making it valuable for biotechnological applications . To investigate TVP23's role in these characteristics:
Physiological Tests:
Compare growth curves of wild-type and TVP23-deficient strains under various salt concentrations, pH conditions, and temperatures
Measure intracellular glycerol accumulation (a key osmolyte) in response to osmotic stress
Assess cell wall integrity using dyes like Calcofluor White or Congo Red
Molecular Approaches:
Conduct transcriptomic analysis to identify genes differentially expressed in response to stress in wild-type versus TVP23 mutants
Perform metabolomic profiling to detect changes in stress-related metabolites
Conduct phosphoproteomic analysis to identify stress signaling pathway differences
Subcellular Localization:
Track GFP-tagged TVP23 localization under normal and stress conditions
Evaluate Golgi morphology and function during stress exposure
Assess protein trafficking efficiency during osmotic challenge
Efficient transformation is critical for TVP23 functional studies in D. hansenii. Recent methods have significantly improved transformation efficiency:
Optimized Transformation Protocol:
Prepare competent cells from mid-log phase cultures
Use PCR products with 50 bp homology arms flanking the target site
Employ completely heterologous selectable markers like Hygromycin B (hph) or G418 (kanr) resistance cassettes with codon optimization (CTG codons changed to other leucine codons)
Express the resistance markers under control of promoters from related species like Scheffersomyces stipitis (formerly Pichia stipitis)
Select transformants on appropriate antibiotic-containing media
Confirm integration events by PCR and/or Southern blotting
This protocol has achieved transformation efficiency with correct integration at the target site exceeding 75% in wild-type D. hansenii isolates .
Tag Selection Considerations:
His-tag: Commonly used for purification via IMAC as demonstrated with recombinant D. hansenii TVP23
Fluorescent proteins: yemCherry has been successfully used in D. hansenii
Epitope tags: Consider HA, FLAG, or c-Myc for immunodetection
Expression Strategies:
Genomic integration at the native locus for physiological expression levels
Integration at a "safe harbor" site for heterologous expression
Use of S. stipitis TEF1 or ACT1 promoters for constitutive expression
When designing tagged constructs, researchers should avoid disrupting transmembrane domains or functional regions. Based on the amino acid sequence, the N-terminus of TVP23 appears to be hydrophilic and potentially cytoplasmic, making it a suitable location for tags .
Based on studies of TVP23 homologs, this protein likely affects glycosylation pathways by influencing the distribution or activity of glycosylation enzymes in the Golgi apparatus .
Glycosylation Analysis Methods:
Lectin blotting to profile glycan structures
Mass spectrometry (MS) for detailed glycan structure analysis:
MALDI-TOF MS for N-linked glycan profiling
LC-MS/MS for site-specific glycosylation analysis
Fluorescent labeling of glycans followed by HPLC or capillary electrophoresis
Functional Glycomics Approaches:
Glycosyltransferase activity assays using fluorescent substrates
Cell-free reconstitution of glycosylation pathways with purified enzymes and recombinant TVP23
Glycan microarray analysis to identify binding specificities
| Lectin | Source | Glycan Specificity | Application |
|---|---|---|---|
| ConA | Canavalia ensiformis | High-mannose N-glycans | Early N-glycosylation defects |
| WGA | Triticum vulgaris | GlcNAc, sialic acid | Terminal modifications |
| PNA | Arachis hypogaea | Galβ1-3GalNAc | O-glycosylation |
| UEA-I | Ulex europaeus | Fucα1-2Gal | Fucosylation |
| SNA | Sambucus nigra | α2,6-linked sialic acid | Terminal sialylation |
This analytical toolkit will allow researchers to comprehensively characterize the impact of TVP23 on the D. hansenii glycosylation machinery and downstream effects on cellular physiology.