Recombinant Debaryomyces hansenii Golgi apparatus membrane protein TVP23 (TVP23)

Shipped with Ice Packs
In Stock

Description

Introduction to TVP23 Protein

TVP23 is a transmembrane protein localized to the Golgi apparatus, an essential organelle responsible for protein processing, modification, and trafficking in eukaryotic cells. The Debaryomyces hansenii TVP23 protein belongs to a highly conserved family of membrane proteins found across fungal species from yeast to filamentous fungi, with homologs also present in higher eukaryotes including humans . This conservation across evolutionary distances suggests essential cellular functions that have been maintained throughout eukaryotic evolution.

The protein was initially characterized alongside other novel membrane proteins (Tvp38, Tvp18, and Tvp15) in Saccharomyces cerevisiae through proteomic analysis of immunoisolated Golgi subcompartments . These proteins were found to mainly localize in Tlg2-containing compartments, suggesting roles in late Golgi/endosomal trafficking systems.

Protein Structure and Sequence

The recombinant Debaryomyces hansenii TVP23 protein consists of 227 amino acids spanning the full length of the native protein. The protein's amino acid sequence is:

MNSAYTAIESDVPEQAQQPSAQSNATSAGANVSPSEWTWSQKLKESSHPIALLFYIFFRV SPLFIYLFGTLLIGIITKKNKFILHFIIIVLLVSGDFWNLKNIAGRLLVGLRWWNEVSVI KSTNGEFENVWVFETVDPNRYINPIDSKVFWTLLYVQPAAWVVLGFLALLKFEFLYLLLI IISISLSLTNAMAFTKCDKFGKANHLATDIFSRATGNLFSRLNPFST

Analysis of this sequence reveals multiple hydrophobic regions consistent with a multi-pass transmembrane protein architecture, which aligns with its function as a Golgi membrane protein. The Debaryomyces hansenii TVP23 is cataloged in protein databases with the UniProt ID Q6BVH1 and has synonyms including DEHA2C02728g .

Protein Reconstitution and Handling

For optimal use in experimental settings, the manufacturer recommends reconstituting the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol (5-50% final concentration) is recommended for long-term storage, with 50% being the default recommendation . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to maintain protein quality and activity.

Role in Golgi Trafficking and Membrane Organization

While the specific functions of Debaryomyces hansenii TVP23 have not been extensively characterized, insights from homologous proteins in other organisms provide valuable information. In Saccharomyces cerevisiae, TVP23 is non-essential for growth under laboratory conditions but plays roles in the maintenance and function of late Golgi/endosomal compartments .

The yeast homolog of TVP23 exists in an interactive network with Yip1-family proteins, specifically Yip4 and Yip5, which collectively assist in maintaining Golgi/endosomal compartment integrity and function . Genetic studies have shown that disruption of tvp23 exhibits synthetic aggravation when combined with ypt6 or ric1 null mutations, suggesting potential functional redundancy or cooperative roles with these proteins in vesicular trafficking .

Insights from Mammalian Homologs

The mammalian homolog TVP23B provides additional insights into the potential functions of this protein family. TVP23B has been identified as crucial for intestinal homeostasis, controlling the function of specialized secretory cells including Paneth cells and goblet cells . This suggests a conserved role for TVP23 family proteins in regulating secretory pathways across eukaryotes.

TVP23B binds with another Golgi protein, YIPF6, and deficiency in either protein leads to common deficiencies in several critical glycosylation enzymes in the Golgi apparatus . This indicates that TVP23 family proteins may be involved in maintaining proper enzyme composition within the Golgi, potentially affecting protein glycosylation and subsequent secretion.

Molecular Interactions

Studies of yeast TVP23 suggest potential RNA interactions. Prediction analyses indicate possible interactions with various RNAs, including those encoded by genes such as YML009W-B, NOP1, and NSR1, although these interactions have moderate prediction scores . These potential interactions require further validation but suggest possible roles in RNA biology or regulation.

Comparison with TVP23 from Other Species

The TVP23 protein family shows considerable conservation across species while maintaining species-specific features. For comparison, the Laccaria bicolor TVP23 homolog consists of 266 amino acids and shows some sequence similarity to D. hansenii TVP23 . The amino acid sequences of TVP23 proteins from different species reflect both conserved functional domains and species-specific adaptations.

The conservation of TVP23 across diverse fungal species, including both unicellular yeasts like D. hansenii and filamentous fungi like L. bicolor, highlights the evolutionary importance of this protein family. These proteins appear to have maintained similar subcellular localization and general functions while potentially adapting to species-specific requirements of Golgi organization and trafficking.

Research Applications

Recombinant D. hansenii TVP23 serves as a valuable research tool for studying:

  1. Golgi membrane protein structure and dynamics

  2. Protein trafficking pathways in eukaryotic cells

  3. Comparative analysis of Golgi organization across fungal species

  4. Development of specific antibodies for protein detection and localization studies

The availability of purified recombinant protein facilitates biochemical and structural studies that were previously challenging with membrane proteins. This enables detailed characterization of protein-protein interactions and potential post-translational modifications that may regulate TVP23 function.

Biotechnological Potential

Understanding Golgi membrane proteins like TVP23 has potential applications in biotechnology, particularly in:

  1. Engineering improved protein secretion pathways in yeast expression systems

  2. Developing novel antifungal targets, given the importance of the Golgi apparatus in fungal cell biology

  3. Optimization of heterologous protein production in industrial strains of yeast

  4. Biomedical research into disorders related to Golgi trafficking defects

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TVP23; DEHA2C02728g; Golgi apparatus membrane protein TVP23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
TVP23
Target Protein Sequence
MNSAYTAIESDVPEQAQQPSAQSNATSAGANVSPSEWTWSQKLKESSHPIALLFYIFFRV SPLFIYLFGTLLIGIITKKNKFILHFIIIVLLVSGDFWNLKNIAGRLLVGLRWWNEVSVI KSTNGEFENVWVFETVDPNRYINPIDSKVFWTLLYVQPAAWVVLGFLALLKFEFLYLLLI IISISLSLTNAMAFTKCDKFGKANHLATDIFSRATGNLFSRLNPFST
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP23 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How does D. hansenii TVP23 compare to homologous proteins in other organisms?

TVP23 belongs to a protein family that is highly conserved across fungal species and has homologs in higher eukaryotes. In mammals, the homologous protein TVP23B has been shown to regulate host-microbe interactions in the intestine by controlling the homeostasis of Paneth cells and the function of goblet cells . This results in the regulation of antimicrobial peptides and affects the integrity of the mucus layer .

In yeast model systems, the TVP23 family proteins interact with other Golgi proteins such as YIPF6, which is critical for intestinal homeostasis . The Golgi proteomes of cells deficient in these proteins show common deficiencies in several critical glycosylation enzymes, suggesting a conserved role in glycosylation processes across species .

What methods are effective for heterologous expression and purification of D. hansenii TVP23?

Expression Protocol:

  • Clone the TVP23 gene into a suitable expression vector with an N-terminal His tag

  • Transform into E. coli expression strain (BL21(DE3) or similar)

  • Induce expression with IPTG at reduced temperature (16-20°C) to enhance proper folding

  • Harvest cells and disrupt by sonication or French press

  • Solubilize membrane fraction with appropriate detergents (e.g., DDM, CHAPS)

Purification Strategy:

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Apply a detergent-containing buffer to maintain protein solubility

  • Elute with imidazole gradient

  • Conduct size exclusion chromatography for further purification

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Storage Recommendations:
Store the purified protein at -20°C/-80°C with 5-50% glycerol added to prevent freeze damage . Avoid repeated freeze-thaw cycles and consider storing working aliquots at 4°C for up to one week .

What genetic manipulation techniques can be applied to study TVP23 function in D. hansenii?

Recent advances have made gene targeting in D. hansenii more accessible and efficient. A PCR-based method allows for gene targeting at high efficiency (>75%) in wild-type isolates without requiring auxotrophic markers .

PCR-based gene targeting protocol:

  • Design primers with 50 bp flanks homologous to regions surrounding the TVP23 gene

  • Amplify a heterologous selectable marker (hygromycin B or G418 resistance cassettes)

  • Transform D. hansenii cells with the PCR product

  • Select transformants on appropriate antibiotic-containing media

  • Verify gene disruption by PCR and/or Western blot analysis

For expression of modified versions of TVP23, researchers can use a "safe harbor" integration site in the genome, which has been demonstrated as an effective approach for heterologous protein expression in D. hansenii .

How can researchers investigate TVP23's role in Golgi function and cellular physiology?

Interaction Studies:

  • Perform co-immunoprecipitation experiments to identify TVP23 binding partners

  • Use yeast two-hybrid or BioID proximity labeling to map the interactome

  • Analyze interactions with other Golgi proteins, particularly YIPF6, which has been shown to interact with TVP23 homologs

Functional Assays:

  • Assess Golgi morphology in TVP23 knockout or overexpression strains using fluorescence microscopy

  • Evaluate protein glycosylation patterns using lectin blotting or mass spectrometry

  • Measure secretion efficiency of model proteins

  • Analyze lipid composition of Golgi membranes

Cellular Stress Response:
D. hansenii is known for its osmotolerance and stress tolerance characteristics . Researchers can investigate how TVP23 contributes to these properties by:

  • Comparing growth of wild-type and TVP23-deficient strains under various stress conditions

  • Measuring stress response pathway activation

  • Assessing changes in membrane composition and integrity

What are the strain-specific variations in TVP23 function across D. hansenii isolates?

D. hansenii strains exhibit diverse properties that could extend to variations in TVP23 function . Studies have shown that different isolates respond differently to genetic manipulations, with some showing unexpected phenotypic effects .

Comparative analysis approach:

  • Sequence TVP23 genes from multiple D. hansenii strains to identify polymorphisms

  • Generate TVP23 knockouts in diverse strain backgrounds

  • Perform complementation studies with TVP23 variants

  • Compare phenotypes across strains under various conditions

One study noted that in certain D. hansenii isolates, gene disruption attempts resulted in the presence of both disrupted and wild-type gene copies, suggesting genomic peculiarities that researchers should account for in experimental design .

What considerations should researchers address when establishing material transfer agreements for D. hansenii strains or constructs?

When obtaining or sharing D. hansenii strains or TVP23 constructs, researchers should carefully consider material transfer agreement (MTA) terms to preserve academic freedom and future research opportunities .

Key MTA considerations:

  • Avoid terms that restrict publication rights or impose excessive publication delays

  • Be cautious of clauses asserting extensive ownership rights in research results

  • Watch for inappropriate indemnification requirements

  • Identify potential conflicts with other funding sources or material obligations

  • Consider the impact on student researchers whose careers may depend on unrestricted use of research results

For NIH-funded research in the U.S., follow the NIH Research Tools Policy, which encourages broad dissemination of research tools with minimal encumbrances .

How can researchers validate the functional integrity of recombinantly expressed TVP23?

Structural Validation:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Limited proteolysis to evaluate folding quality

  • Size exclusion chromatography to confirm monodispersity

Functional Validation:

  • Liposome binding or reconstitution assays to confirm membrane association

  • In vitro interaction studies with known binding partners

  • Complementation assays in TVP23-deficient strains

  • Localization studies using fluorescently-tagged TVP23 to confirm Golgi targeting

Activity Assays:
Based on homology to TVP23B, which affects glycosylation enzymes in the Golgi , researchers could:

  • Test whether recombinant TVP23 affects glycosyltransferase activity in vitro

  • Evaluate its ability to restore normal glycosylation patterns in TVP23-depleted cells

  • Assess its capacity to bind or modify relevant Golgi lipids

What experimental approaches can determine TVP23's role in D. hansenii stress tolerance?

D. hansenii is recognized for its exceptional osmotolerance, stress tolerance, and oleaginous nature, making it valuable for biotechnological applications . To investigate TVP23's role in these characteristics:

Physiological Tests:

  • Compare growth curves of wild-type and TVP23-deficient strains under various salt concentrations, pH conditions, and temperatures

  • Measure intracellular glycerol accumulation (a key osmolyte) in response to osmotic stress

  • Assess cell wall integrity using dyes like Calcofluor White or Congo Red

Molecular Approaches:

  • Conduct transcriptomic analysis to identify genes differentially expressed in response to stress in wild-type versus TVP23 mutants

  • Perform metabolomic profiling to detect changes in stress-related metabolites

  • Conduct phosphoproteomic analysis to identify stress signaling pathway differences

Subcellular Localization:

  • Track GFP-tagged TVP23 localization under normal and stress conditions

  • Evaluate Golgi morphology and function during stress exposure

  • Assess protein trafficking efficiency during osmotic challenge

How can researchers optimize D. hansenii transformation for TVP23 studies?

Efficient transformation is critical for TVP23 functional studies in D. hansenii. Recent methods have significantly improved transformation efficiency:

Optimized Transformation Protocol:

  • Prepare competent cells from mid-log phase cultures

  • Use PCR products with 50 bp homology arms flanking the target site

  • Employ completely heterologous selectable markers like Hygromycin B (hph) or G418 (kanr) resistance cassettes with codon optimization (CTG codons changed to other leucine codons)

  • Express the resistance markers under control of promoters from related species like Scheffersomyces stipitis (formerly Pichia stipitis)

  • Select transformants on appropriate antibiotic-containing media

  • Confirm integration events by PCR and/or Southern blotting

This protocol has achieved transformation efficiency with correct integration at the target site exceeding 75% in wild-type D. hansenii isolates .

What protein expression tags are optimal for D. hansenii TVP23 studies?

Tag Selection Considerations:

  • His-tag: Commonly used for purification via IMAC as demonstrated with recombinant D. hansenii TVP23

  • Fluorescent proteins: yemCherry has been successfully used in D. hansenii

  • Epitope tags: Consider HA, FLAG, or c-Myc for immunodetection

Expression Strategies:

  • Genomic integration at the native locus for physiological expression levels

  • Integration at a "safe harbor" site for heterologous expression

  • Use of S. stipitis TEF1 or ACT1 promoters for constitutive expression

When designing tagged constructs, researchers should avoid disrupting transmembrane domains or functional regions. Based on the amino acid sequence, the N-terminus of TVP23 appears to be hydrophilic and potentially cytoplasmic, making it a suitable location for tags .

What analytical techniques are most informative for studying TVP23's impact on cellular glycosylation?

Based on studies of TVP23 homologs, this protein likely affects glycosylation pathways by influencing the distribution or activity of glycosylation enzymes in the Golgi apparatus .

Glycosylation Analysis Methods:

  • Lectin blotting to profile glycan structures

  • Mass spectrometry (MS) for detailed glycan structure analysis:

    • MALDI-TOF MS for N-linked glycan profiling

    • LC-MS/MS for site-specific glycosylation analysis

  • Fluorescent labeling of glycans followed by HPLC or capillary electrophoresis

Functional Glycomics Approaches:

  • Glycosyltransferase activity assays using fluorescent substrates

  • Cell-free reconstitution of glycosylation pathways with purified enzymes and recombinant TVP23

  • Glycan microarray analysis to identify binding specificities

Table 1: Recommended Lectins for Analyzing Glycosylation Changes in TVP23 Studies

LectinSourceGlycan SpecificityApplication
ConACanavalia ensiformisHigh-mannose N-glycansEarly N-glycosylation defects
WGATriticum vulgarisGlcNAc, sialic acidTerminal modifications
PNAArachis hypogaeaGalβ1-3GalNAcO-glycosylation
UEA-IUlex europaeusFucα1-2GalFucosylation
SNASambucus nigraα2,6-linked sialic acidTerminal sialylation

This analytical toolkit will allow researchers to comprehensively characterize the impact of TVP23 on the D. hansenii glycosylation machinery and downstream effects on cellular physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.