Recombinant Debaryomyces hansenii Golgi apparatus membrane protein TVP38 (TVP38)

Shipped with Ice Packs
In Stock

Description

Overview of TVP38 in Debaryomyces hansenii

TVP38 is a transmembrane protein localized to the Golgi apparatus in Debaryomyces hansenii, a yeast species known for its osmotolerance and industrial relevance . The recombinant form is produced using heterologous expression systems, enabling biochemical and functional studies. Key features include:

  • UniProt ID: Q6BQJ1

  • Sequence: 383 amino acids with predicted transmembrane helices and conserved domains linked to vesicle trafficking .

  • Expression: Typically expressed in Escherichia coli or yeast systems, fused with tags (e.g., His-tag) for purification .

Functional Role in Membrane Trafficking

TVP38 homologs are implicated in:

  • Vesicle formation: Mediates cargo selection and vesicle budding in the Golgi .

  • Membrane integrity: Stabilizes internal membranes, as observed in cyanobacterial and chloroplast homologs .

  • Conservation: Shares functional homology with Kluyveromyces lactis TVP38 (UniProt Q6CXJ8) and S. cerevisiae TVP38 (SGD ID S000001796) .

Key studies:

  • In S. cerevisiae, TVP38 co-localizes with late Golgi markers (e.g., Tlg2) and interacts with SNARE-associated proteins .

  • D. hansenii TVP38 is non-essential under laboratory conditions but critical in stress responses due to its membrane-stabilizing role .

Expression Systems

ParameterDetails
Host organismE. coli (common) or yeast systems .
TagN-terminal His-tag for affinity purification .
Purity>90% (verified by SDS-PAGE) .
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C .

Biotechnological Potential

  • Stress tolerance engineering: D. hansenii’s osmotolerance makes TVP38 relevant for industrial strains .

  • Protein secretion: Recombinant TVP38 aids in studying secretory pathways for heterologous protein production .

Comparative Analysis with Homologs

SpeciesUniProt IDLength (aa)Key FeaturesReference
Debaryomyces hanseniiQ6BQJ1383Golgi membrane localization, DedA domain .
Kluyveromyces lactisQ6CXJ8305His-tagged recombinant form, E. coli expression .
Saccharomyces cerevisiaeS000001796305Non-essential, co-localizes with Tlg2 .

Research Gaps and Future Directions

  • Mechanistic insights: The exact role of conserved motifs (e.g., GxxxM/VxxxxF/Y) remains uncharacterized .

  • Biotechnological optimization: Enhanced expression systems for D. hansenii TVP38 could improve industrial applications .

  • Evolutionary studies: Functional divergence between fungal and cyanobacterial homologs warrants exploration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
TVP38; DEHA2E04840g; Golgi apparatus membrane protein TVP38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
TVP38
Target Protein Sequence
MPRLPSSSDPFQGHNELPQSNNFMSRTNSIIQDKLFLVRNVGQQTLDWYQSQPLWKRTLL QVLFVFNAIVVVLIMIFHKSIIQAIVVISDKWHGLKFGQGLLFTLVFMVGFPPLLGFSAL SMLAGMVYGFVHGWILLACASISGSFCSFLVFRYLLHSRAERLMNSNKKFRAFSEILRED SSLFILVLLRLCPLPYSLSNGALAAIPELPATTYFLASLITSPKLMIHIFVGHKLKELGD DTKGKSTHLIDILSIIITGAAASLTTYIIYNKMQRKLEFYHQRGIIPRDDAIIFGNFEDI ESANNVELNSADYDEDNFIIEDEDDENATDPDYVASKKNIQVHAEDQNKNGEFEIDENDG VDDLGLGEISKNSKQNTNGYRDY
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking and spindle migration.
Database Links
Protein Families
TVP38/TMEM64 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii and why is it significant in biotechnology research?

Debaryomyces hansenii is a hemiascomycetous yeast with remarkable adaptability to extreme conditions, including high salt concentrations and alkaline pH environments. It exhibits high respiratory and low fermentative activity, with fermentation characteristics varying significantly between strains . This yeast is abundant in cheese (found in over 50% of cheeses examined) and dry-meat products, and serves as a model organism for studying osmotic adaptation mechanisms .

D. hansenii has garnered significant research interest due to its diverse biotechnological applications, including production of xylitol, lipases, exopeptidases, and thermophilic β-glucosidases. It can grow using different carbon sources and notably produces killer toxins effective against pathogenic Candida species . Recent research has also demonstrated its potential as a probiotic in aquaculture and as a biocontrol agent against food spoilage fungi .

How is recombinant TVP38 protein produced and stored for experimental use?

The production of recombinant D. hansenii TVP38 involves several methodological steps:

  • Gene cloning: The TVP38 gene sequence is isolated from D. hansenii genomic DNA or cDNA and cloned into an appropriate expression vector.

  • Expression system selection: While the specific expression system used for commercial recombinant TVP38 is not detailed in the search results, typical hosts include E. coli, yeast, or insect cells, each with different advantages for membrane protein expression.

  • Protein purification: Approaches typically involve affinity chromatography using tags incorporated into the recombinant protein. According to available information, the tag type for TVP38 is determined during the production process .

  • Quality control: The purified protein undergoes verification for identity, purity, and structural integrity through methods such as SDS-PAGE, mass spectrometry, and activity assays.

For optimal storage, recombinant TVP38 is maintained in a Tris-based buffer with 50% glycerol specifically optimized for this protein. The recommended storage conditions are -20°C for regular use and -80°C for extended storage. Working aliquots can be kept at 4°C for up to one week, and repeated freeze-thaw cycles should be avoided to maintain protein integrity .

What experimental techniques are suitable for studying recombinant TVP38 function?

Several experimental approaches can be employed to investigate TVP38 function:

  • ELISA-based assays: The recombinant protein is specifically prepared for use in ELISA applications, allowing for protein-protein interaction studies and antibody development .

  • Localization studies: Fluorescent tagging combined with confocal microscopy can reveal TVP38's precise subcellular localization and potential redistribution under different conditions.

  • Protein-protein interaction mapping: Techniques such as co-immunoprecipitation, proximity labeling (BioID or APEX), or yeast two-hybrid assays can identify TVP38 interaction partners.

  • Functional complementation: Expression of D. hansenii TVP38 in other yeast species with deleted homologous genes can assess functional conservation.

  • Structural characterization: Approaches including cryo-electron microscopy, X-ray crystallography, or NMR spectroscopy can elucidate TVP38's 3D structure, though membrane proteins present significant challenges for structural determination.

  • Membrane topology analysis: Protease protection assays, glycosylation site mapping, or cysteine scanning mutagenesis can determine the orientation of TVP38 in the Golgi membrane.

How does TVP38 potentially contribute to D. hansenii's exceptional salt tolerance mechanisms?

D. hansenii is regarded as a model organism for studying osmotic adaptations and salt tolerance . While direct evidence linking TVP38 to these adaptive processes is limited, several experimental approaches can investigate this relationship:

  • Expression analysis under salt stress: Quantifying TVP38 mRNA and protein levels under various salt concentrations could reveal correlation with stress responses. Methodologically, this requires:

    • qRT-PCR for transcript quantification

    • Western blotting with anti-TVP38 antibodies for protein quantification

    • Ribosome profiling to assess translational efficiency under stress

  • Functional genetics approaches: Creating TVP38 knockout, knockdown, or overexpression strains and assessing their salt tolerance phenotypes. This would involve:

    • CRISPR-Cas9 gene editing or RNAi for TVP38 depletion

    • Growth curve analysis under various salt concentrations

    • Complementation studies to confirm phenotype specificity

  • Golgi function under salt stress: As a Golgi membrane protein, TVP38 might influence protein glycosylation or trafficking under high salt conditions, potentially affecting:

    • Cell wall composition and integrity

    • Surface protein modifications

    • Secretion of osmoprotectants

  • Protein interaction studies: TVP38 may interact with known osmoadaptation proteins. Techniques like BioID proximity labeling or co-immunoprecipitation could identify salt-stress-specific interactions.

Experimental ApproachMethodologyExpected OutcomesControls Required
TVP38 expression profilingqRT-PCR, Western blotExpression patterns under varying salt concentrationsHousekeeping genes, non-stressed conditions
Salt tolerance phenotypingGrowth curves, spot assaysGrowth differences between wild-type and TVP38 mutantsComplemented strains, other membrane protein mutants
Golgi function assessmentGlycosylation analysis, vesicle trackingChanges in post-translational modifications, trafficking defectsOther Golgi proteins as references
Membrane integrity analysisFluorescent dyes, electron microscopyDifferences in membrane composition or organizationStandard membrane markers

What is the relationship between TVP38 and D. hansenii's ability to produce killer toxins against Candida species?

D. hansenii produces killer toxins (mycocins) effective against pathogenic Candida species, with activity varying based on pH (4.5-6.0) and temperature (20-35°C) . Investigating TVP38's potential role in this process requires sophisticated methodological approaches:

  • Correlation analysis: Determine whether TVP38 expression levels correlate with killer toxin production across different D. hansenii strains and growth conditions using:

    • Parallel quantification of TVP38 expression and killer toxin activity

    • Comparative analysis across the 42 D. hansenii strains previously isolated from cheese

    • Statistical correlation analysis between expression and activity levels

  • Genetic manipulation: Create TVP38-modified strains to assess impact on killer toxin production:

    • Generate TVP38 knockout and overexpression strains

    • Quantify killer toxin production using agar diffusion well bioassay

    • Measure activity against C. albicans and C. tropicalis as model targets

  • Secretory pathway analysis: As a Golgi membrane protein, TVP38 might be involved in killer toxin trafficking:

    • Fluorescently tag killer toxins and track their intracellular movement

    • Perform subcellular fractionation to identify compartments where killer toxin processing occurs

    • Conduct electron microscopy to visualize secretory vesicles in wild-type versus TVP38 mutants

  • Post-translational modification profiling: TVP38 may influence killer toxin glycosylation or other modifications:

    • Perform mass spectrometry analysis of killer toxins from wild-type versus TVP38 mutants

    • Assess glycosylation patterns using lectin binding assays

    • Correlate modifications with antimicrobial activity

The experimental design should incorporate the optimal conditions for killer toxin activity (pH 4.5-5.5, temperature 20-30°C) identified in previous studies .

How can TVP38 be utilized to enhance D. hansenii's probiotic effects in aquaculture applications?

Recent research has demonstrated D. hansenii's effectiveness as a probiotic in fish diets, particularly in gilthead seabream (Sparus aurata), where it improved growth, feed conversion, and modulated immune responses . To leverage TVP38 in this context:

  • Expression optimization: Modify TVP38 expression levels to enhance D. hansenii's beneficial properties:

    • Engineer strains with optimized TVP38 expression

    • Test different promoters to regulate expression under gut conditions

    • Evaluate growth and survival in simulated fish gut environments

  • TVP38 variants screening: Create and screen TVP38 variants for enhanced functionality:

    • Perform site-directed mutagenesis targeting key functional domains

    • Create chimeric proteins with homologs from other probiotic yeasts

    • Test variants for improved stability under gastrointestinal conditions

  • Host-microbe interaction studies: Investigate how TVP38 affects D. hansenii's interactions with fish cells:

    • Co-culture with fish intestinal epithelial cells or immune cells

    • Assess adhesion capabilities and immunomodulatory effects

    • Identify host receptors that potentially interact with D. hansenii surface components

Research has shown that dietary supplementation with D. hansenii at 1.1% significantly improved fish performance and modulated 712 differentially expressed genes in skin tissue . Understanding TVP38's role could help optimize these effects.

ParameterControl Diet1.1% D. hansenii2.2% D. hanseniiPotential TVP38 Contribution
Growth performanceBaselineIncreasedIntermediateCould influence secretion of growth-promoting factors
Feed conversion ratioBaselineImprovedIntermediateMay affect nutrient utilization or metabolite production
Immune gene modulationBaseline712 DEGs (53.4% up, 46.6% down)Not specifiedMight influence surface components that trigger immune responses
B and T-cell pathwaysNormal regulationStrong modulation (61 DEGs)Not specifiedCould affect secretion of immunomodulatory compounds

What methodological approaches can determine TVP38's role in D. hansenii's resistance to fermentation inhibitors?

D. hansenii has been noted for its ability to grow in the presence of fermentation inhibitors such as furfural, vanillin, and organic acids . Investigating TVP38's role in this resistance requires:

  • Differential expression analysis: Determine how TVP38 expression changes when D. hansenii is exposed to different inhibitors:

    • RNA-Seq or qRT-PCR to quantify transcript levels

    • Proteomics to assess protein abundance and modifications

    • Time-course analysis to track expression dynamics during adaptation

  • Functional genetics approaches: Create TVP38-modified strains and assess their inhibitor resistance:

    • Generate knockout and overexpression strains using CRISPR-Cas9 or plasmid-based systems

    • Perform growth assays in the presence of varying inhibitor concentrations

    • Measure metabolic activity using techniques like respirometry or ATP quantification

  • Cellular physiology assessment: Evaluate how TVP38 affects cellular responses to inhibitors:

    • Membrane integrity analysis using fluorescent dyes

    • Golgi morphology and function studies using microscopy and glycosylation assays

    • Metabolite profiling to identify detoxification pathways

  • Stress response pathway integration: Determine how TVP38 interacts with known stress response mechanisms:

    • Epistasis analysis with other stress response genes

    • Phosphoproteomics to identify signaling pathways involving TVP38

    • Transcription factor binding analysis to identify regulatory connections

These approaches would help determine whether TVP38 plays a direct role in inhibitor resistance or influences broader cellular processes that contribute to D. hansenii's robustness in challenging environments.

How can structure-function analysis of TVP38 inform its optimization for biotechnological applications?

Structure-function analysis of TVP38 could reveal key insights for biotechnological applications. Using the available amino acid sequence , several methodological approaches are recommended:

  • Computational structural analysis:

    • Predict TVP38 3D structure using AlphaFold2 or similar tools

    • Identify conserved domains through comparative sequence analysis

    • Perform molecular dynamics simulations under different environmental conditions

    • Predict protein-protein interaction interfaces

  • Targeted mutagenesis for functional mapping:

    • Conduct alanine scanning mutagenesis of predicted functional residues

    • Create truncation variants to identify essential domains

    • Introduce site-specific mutations in conserved motifs

    • Develop reporter fusions to track localization and activity

  • Domain swapping and chimeric proteins:

    • Exchange domains with homologs from other yeast species

    • Create fusion proteins with additional functionalities

    • Introduce domains from stress-responsive proteins

    • Engineer conditional activity through responsive domains

  • Structure-guided optimization:

    • Modify surface-exposed residues to enhance stability

    • Introduce disulfide bridges for improved thermostability

    • Optimize glycosylation sites for enhanced secretion

    • Modify membrane interaction domains for altered localization

Structural FeaturePotential RoleBiotechnological ApplicationExperimental Approach
Transmembrane domainsMembrane anchoringEnhanced membrane protein expression systemsHydrophobicity analysis, topology mapping
Conserved motifsProtein-protein interactionsEngineering new interaction capabilitiesMotif identification, mutation analysis
Post-translational modification sitesRegulation and stabilityImproved protein productionMass spectrometry, site-directed mutagenesis
Signal sequencesTrafficking and localizationTargeted protein deliveryN-terminal sequence analysis, localization studies

What experimental design would best evaluate TVP38's role in D. hansenii's antifungal activity against food spoilage organisms?

D. hansenii has shown effectiveness against fungal spoilage organisms, particularly Alternaria species in tomatoes, reducing mycotoxin accumulation by 27-92% . To investigate TVP38's potential contribution to this activity:

  • Comparative strain analysis:

    • Compare TVP38 sequences across D. hansenii strains with different antifungal activities

    • Quantify TVP38 expression levels during antagonistic interactions

    • Correlate expression with antifungal compound production

  • Genetic modification approaches:

    • Create TVP38 knockout strains using CRISPR-Cas9 or similar techniques

    • Develop overexpression strains with constitutive or inducible promoters

    • Generate site-specific mutations in functional domains

  • Antagonism assays with modified strains:

    • Perform dual-culture assays against Alternaria species

    • Quantify growth inhibition zones and mycotoxin reduction

    • Conduct time-lapse microscopy to observe interaction dynamics

  • Secretome analysis:

    • Compare secreted protein profiles between wild-type and TVP38 mutants

    • Fractionate supernatants and test antifungal activity

    • Identify bioactive compounds using mass spectrometry

    • Track antifungal compound trafficking through the secretory pathway

Experimental StageMethodologyControlsExpected Outcomes
Initial phenotypingDual-culture assaysNon-antagonistic yeast strainsDifferential inhibition patterns
Genetic modificationCRISPR-Cas9, plasmid expressionEmpty vector, wild-typeConfirmation of TVP38 modification
Antifungal activity testingWell diffusion, co-cultureHeat-inactivated samplesQuantitative inhibition data
Mycotoxin analysisHPLC, mass spectrometryStandard toxin curvesToxin reduction percentages
Mechanism investigationMicroscopy, gene expressionNon-interacting conditionsPathway identification

The experimental design should evaluate efficacy against both Alternaria tenuissima and A. arborescens, the two species previously shown to be inhibited by D. hansenii .

How can TVP38 be integrated into systems biology approaches to optimize D. hansenii for industrial applications?

D. hansenii has been proposed as a superior cell factory for the green transition, particularly for utilizing industrial side-streams and complex feedstocks . Integrating TVP38 into systems biology approaches requires:

  • Multi-omics data integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map TVP38's position in regulatory networks

    • Identify co-expressed genes and potential functional clusters

    • Create predictive models of TVP38's role in various pathways

  • Genome-scale metabolic modeling:

    • Incorporate TVP38 and related secretory pathway components into existing models

    • Simulate the effects of TVP38 modifications on cellular metabolism

    • Predict optimal expression levels for specific applications

    • Identify potential bottlenecks in protein production pipelines

  • Synthetic biology approaches:

    • Design synthetic promoters for controlled TVP38 expression

    • Create genetic circuits that regulate TVP38 in response to environmental cues

    • Develop modular expression cassettes for rapid strain engineering

    • Implement CRISPR-based systems for multiplexed genetic modifications

  • High-throughput phenotyping:

    • Screen libraries of TVP38 variants for improved functionalities

    • Develop reporter systems for real-time monitoring of secretory pathway activity

    • Implement microfluidic systems for single-cell analysis

    • Apply machine learning to identify optimal TVP38 configurations

These integrated approaches would help position TVP38 within D. hansenii's broader cellular context and identify optimal engineering strategies for industrial applications, particularly in challenging environments containing fermentation inhibitors or high salt concentrations .

What are the methodological considerations for studying TVP38's potential involvement in protein glycosylation pathways in D. hansenii?

As a Golgi membrane protein, TVP38 may play a role in protein glycosylation, a critical process for protein function and stability. Methodological approaches to investigate this include:

  • Glycoproteomics analysis:

    • Compare glycoprotein profiles between wild-type and TVP38 mutant strains

    • Identify specific glycosylation changes using mass spectrometry

    • Map affected glycoproteins to cellular pathways

    • Quantify site-specific glycosylation occupancy

  • Glycosyltransferase interaction studies:

    • Investigate whether TVP38 interacts with known glycosyltransferases

    • Perform co-immunoprecipitation experiments with tagged proteins

    • Use proximity labeling methods like BioID to identify neighboring proteins

    • Conduct yeast two-hybrid screening for interaction partners

  • Subcellular localization studies:

    • Determine TVP38's precise localization within Golgi subcompartments

    • Co-localize with markers for early, medial, and trans-Golgi

    • Investigate potential redistribution under stress conditions

    • Perform live-cell imaging to track dynamic behavior

  • Functional complementation experiments:

    • Express TVP38 in yeast strains with glycosylation defects

    • Assess rescue of glycosylation phenotypes

    • Create chimeric proteins with domains from known glycosylation machinery

    • Test complementation across different yeast species

Understanding TVP38's potential role in glycosylation would be particularly relevant for D. hansenii's applications in protein production and could explain some of its unique properties when used as a probiotic or biocontrol agent .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.