Recombinant Debaryomyces hansenii Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
GET1; DEHA2A06930g; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
GET1
Target Protein Sequence
MFDISSSNLLISVLVVLFAKQLINAVGKATLENIGWSAYCKVAPKLGDSKFIALDQKNVE LAKVSKERKSISAQDQYARWTKLNRQFDKLTGEINKLKEETSASRSYISKYIGYMILVTT TLPIWFFRVWFRKAVLFYFPTGVLPHYLEWFLALPFITTGGVGLTIWMSAVNNVVSSVIF LVKFPFEKEVPFPSKEVGNEKTSINKEEVSGTPAAN
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which specifically binds the transmembrane domain of TA proteins in the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the function of the GET1/2 complex in Debaryomyces hansenii?

The GET1/2 complex in D. hansenii, as in other yeasts, functions as an insertase/translocase for tail-anchored (TA) proteins. Recent evidence indicates that the conserved GET1/2 machinery forms a hydrophilic channel in the lipid bilayer . This channel is approximately 2.5 nm wide and dynamically opens and closes. GET3 binding can seal this channel, and when GET3 delivers TA proteins to the GET1/2 complex, the channel facilitates insertion of the transmembrane domain into the ER membrane .

Channel formation by GET1/2 serves dual functions:

  • As an insertase for embedding transmembrane domains into the bilayer

  • As a translocase for moving hydrophilic C-terminal segments across the ER membrane

This mechanism is functionally analogous to the Sec61 translocon channel but specialized for TA proteins .

How do I design primers for cloning D. hansenii GET1?

When designing primers for cloning D. hansenii GET1, follow these methodological steps:

  • Identify the genomic sequence: Use the D. hansenii genome database to find the GET1 gene sequence

  • Design PCR primers: Include the following elements:

    • 20-25 nucleotides complementary to the target sequence

    • Appropriate restriction sites for subsequent cloning

    • 3-6 additional nucleotides at the 5' end to facilitate restriction enzyme binding

    • Consider codon optimization if expressing in a heterologous host

  • For CRISPR-based approaches: Design primers with 50 bp homology flanks to the target site, which has been shown to enable efficient homologous recombination in D. hansenii

  • PCR conditions: Use high-fidelity polymerase and optimize conditions based on D. hansenii's high GC content

What are the characteristics of D. hansenii that may affect GET1 protein function?

D. hansenii possesses several unique characteristics that may influence GET1 protein function:

CharacteristicPotential impact on GET1 function
High salt tolerance (up to 24% NaCl)May alter membrane properties affecting channel dynamics; enhanced activity of some D. hansenii proteins has been observed with NaCl
Adaptation to low temperatureGET1 may have evolved structural features for optimal function at lower temperatures (20-25°C)
Acidic pH preferenceMay affect protein-protein interactions in the GET pathway; D. hansenii proteins often show higher activity at acidic pH
Unique lipid compositionCould influence membrane protein insertion mechanics
Alternative genetic code (CUG clade)Affects protein expression systems and requires specialized genetic tools

What transformation systems work best for D. hansenii?

Several transformation systems have been optimized for D. hansenii with varying efficiencies:

  • PCR-based gene targeting with heterologous markers:

    • Uses 50 bp flanking homology to target genomic loci

    • Achieves integration through homologous recombination at high frequency (>75%)

    • Employs completely heterologous selectable markers (hygromycin B or G418 resistance)

  • ARS-based plasmid transformation:

    • Autonomous replication sequences like DhARS2, DhARS3, and DhARS9 show high transformation efficiency

    • CfARS16 from Candida famata also works well in D. hansenii

    • Can achieve >1.5 × 10^5 transformants/μg DNA using sorbitol as stabilizer

  • CRISPR/Cas9 method:

    • Plasmid-based CRISPR CUG/Cas9 with dominant selection marker (NAT)

    • Enables editing of prototrophic strains

    • Optimal with Dh_RNR2p promoter driving Cas9 expression

    • Single-stranded oligonucleotides (90 nt) sufficient for repair templates

How can I optimize the expression of recombinant D. hansenii GET1 protein?

Optimizing recombinant D. hansenii GET1 expression requires addressing several technical challenges:

  • Expression system selection:

    • Homologous expression in D. hansenii is optimal but requires specialized vectors

    • For heterologous expression, codon optimization is crucial as D. hansenii belongs to the CUG clade where CUG encodes serine instead of leucine

  • Promoter and terminator optimization:

    • Highest protein yields reported using the TEF1 promoter from Arxula adeninivorans and CYC1 terminator

    • Screening different promoter-terminator combinations is recommended

  • Membrane protein considerations:

    • GET1 has multiple transmembrane domains requiring special solubilization

    • Consider fusion tags that don't interfere with transmembrane domains

    • Co-expression with GET2 may enhance stability and proper folding

  • Purification strategy:

    • Use mild detergents like DDM or LMNG for extraction

    • Consider nanodiscs for maintaining native environment

    • Implement two-step purification (affinity followed by size exclusion)

  • Salt concentration:

    • Maintain 0.5-1.0 M NaCl in buffers as D. hansenii proteins often require salt for stability

What experimental design is recommended for studying D. hansenii GET1 channel activity?

For studying D. hansenii GET1 channel activity, implement this methodological workflow:

  • Reconstitution in artificial membranes:

    • Purify recombinant GET1/2 complex

    • Reconstitute into small unilamellar vesicles (SUVs)

    • Validate correct orientation in SUVs using proteinase K digestion (expect ~82% correct orientation)

  • Channel activity assays:

    • Bulk fluorescence assays: Use pH-sensitive or ion-sensitive fluorescent dyes

    • Microfluidics assays: To measure real-time channel dynamics

    • Controls: Include non-channel-forming membrane proteins (tSNARE or vSNARE) as negative controls and α-hemolysin as positive control

  • Experimental variables to test:

    • Salt concentration gradients (0-2M NaCl)

    • Temperature effects (20-37°C)

    • pH variations (pH 3.0-7.0)

    • Presence of GET3 and TA substrate proteins

  • Data analysis approach:

    • Measure channel opening/closing kinetics

    • Calculate channel diameter (expected ~2.5 nm based on other yeast species)

    • Assess effects of environmental factors on channel properties

How can I develop CRISPR/Cas9 systems for D. hansenii GET1 modification?

Developing CRISPR/Cas9 systems for D. hansenii GET1 modification requires specialized approaches:

  • Vector construction:

    • Use plasmid designs with h-ARS (fusion of CfARS16 and panARS) for efficient plasmid replication

    • Implement the tRNA-based sgRNA expression cassette (CRISPR CUG-tRNA) for optimal sgRNA production

    • Select Dh_RNR2p promoter for Cas9 expression to minimize toxicity

  • sgRNA design for GET1:

    • Identify unique 20-bp target sequences in GET1

    • Avoid sequences containing homopolymers of >4 bp (e.g., TTTT)

    • Use RNA pol II promoter which doesn't terminate at homopolymers (expanding targeting options)

  • Genetic background optimization:

    • Consider using NHEJ-deficient D. hansenii strain (ku70 deletion) for highest efficiency

    • In NHEJ-deficient backgrounds, CRISPR-mediated gene targeting accuracy approaches 94-97%

  • Repair template design:

    • For point mutations: 90-nt single-stranded oligonucleotides are sufficient

    • For gene deletions: ~400 bp homology arms recommended

    • For knock-ins: PCR products with 50 bp flanking homology

How can I analyze and resolve contradictions in D. hansenii GET1 experimental data?

When facing contradictory experimental results in D. hansenii GET1 research, implement this systematic approach:

  • Validation of experimental conditions:

    • Test multiple environmental conditions as D. hansenii proteins function optimally at:

      • Higher salt concentrations (0.5-1.0 M NaCl enhances activity)

      • Lower temperatures (20-25°C rather than 37°C)

      • Acidic pH (activity peaks at pH 4.5 and below)

    • Duration of experiments: Activity of some D. hansenii proteins drops quickly at 37°C (within 3 hours)

  • Strain verification:

    • Sequence-verify all strains as some D. hansenii isolates may retain wild-type gene copies despite apparent successful disruption

    • Some isolates show no phenotypic effects from gene disruptions due to additional gene copies

  • Methodological cross-validation:

    • Implement a contradictory data detection framework similar to the one described for RAG systems :

      • Detect self-contradictions within a single experiment

      • Identify pairwise contradictions between experiments

      • Assess conditional contradictions involving three or more variables

  • Validation tests for contradictory findings:

    • Use paired genetic approaches: CRISPR/Cas9 and traditional homologous recombination

    • Implement parallel phenotypic and molecular assays

    • Cross-validate with orthologous proteins from related yeasts

What methods can reveal structure-function relationships in D. hansenii GET1?

To investigate structure-function relationships in D. hansenii GET1, combine these methodological approaches:

  • Mutagenesis strategies:

    • Target positively charged residues in transmembrane domains (equivalent to K150 and K157 in Get2) that contribute to channel formation

    • Perform alanine scanning of conserved residues

    • Create GET1 variants with systematic mutations at the GET3 binding interface

  • Functional assays:

    • Measure TA protein insertion efficiency with wild-type vs. mutant GET1

    • Assess membrane channel conductance using electrophysiology

    • Quantify GET1-GET3 binding affinity with surface plasmon resonance

  • Structural biology approaches:

    • Express and purify GET1 using optimized D. hansenii expression systems

    • Perform cryo-EM of the GET1/2 complex with and without GET3 or TA substrates

    • Implement fluorescence-based conformational dynamics studies

  • Data integration:

    • Map functional effects of mutations onto structural models

    • Correlate channel dynamics with insertion efficiency

    • Compare structure-function relationships across different yeast species in varying salt conditions

What control experiments are essential when studying recombinant D. hansenii GET1?

Essential control experiments when studying recombinant D. hansenii GET1 include:

  • Genetic controls:

    • GET1 knockout strains to validate phenotypes

    • GET1 complementation with wild-type gene to confirm function

    • GET1 point mutants affecting key functional residues

    • GET2 knockout to assess interdependence of complex components

  • Expression controls:

    • Western blot verification of expression levels

    • Subcellular localization verification using fluorescent tags

    • Expression of known GET1 homologs from other yeasts (e.g., S. cerevisiae)

  • Functional controls:

    • Non-channel forming membrane proteins (tSNARE/vSNARE) as negative controls

    • Known channel-forming proteins (α-hemolysin) as positive controls

    • GET3 binding assays with and without substrate TA proteins

  • Environmental controls:

    • Salt concentration series (0-2M NaCl)

    • Temperature variations (20-37°C)

    • pH range experiments (pH 4.0-7.0)

How can I design experiments to study GET1-mediated protein insertion in high-salt environments?

To study GET1-mediated protein insertion in high-salt environments characteristic of D. hansenii:

  • In vitro reconstitution system:

    • Purify D. hansenii GET1/2 complex

    • Reconstitute in liposomes with varying lipid compositions

    • Prepare fluorescently labeled TA protein substrates

    • Establish a salt gradient experimental matrix:

    NaCl ConcentrationMembrane CompositionTemperaturepHExpected Effect
    0 MStandard phospholipids25°C7.0Baseline activity
    0.5 MStandard phospholipids25°C7.0Enhanced activity
    1.0 MStandard phospholipids25°C7.0Optimal activity
    1.5 MStandard phospholipids25°C7.0Tolerance test
    1.0 MD. hansenii-mimetic25°C7.0Native conditions
    1.0 MStandard phospholipids20°C4.5Optimal D. hansenii conditions
  • Real-time assays:

    • Measure insertion kinetics using FRET-based reporters

    • Track channel opening/closing dynamics with ion-sensitive dyes

    • Quantify GET3-GET1/2 interaction strength at different salt concentrations

  • Comparative analysis:

    • Compare D. hansenii GET1/2 with orthologs from non-halotolerant yeasts

    • Assess structural adaptations that enable salt tolerance

    • Identify salt-dependent conformational changes

How do I troubleshoot failed expression of recombinant D. hansenii GET1?

When troubleshooting failed expression of recombinant D. hansenii GET1, investigate these potential issues:

  • Codon optimization issues:

    • D. hansenii belongs to the CUG clade (CUG encodes serine instead of leucine)

    • Verify all CUG codons in your expression construct

    • Consider using D. hansenii as expression host instead of standard hosts

  • Expression system problems:

    • Test different promoters (TEF1 from A. adeninivorans shows highest expression)

    • Verify terminator functionality (CYC1 terminator recommended)

    • For heterologous expression, try specialized membrane protein expression strains

  • Protein toxicity:

    • Implement inducible expression systems

    • Co-express with GET2 to form the native complex

    • Express as fusion with solubility-enhancing partners

  • Methodological troubleshooting workflow:

    • Verify construct by sequencing

    • Check protein expression using Western blot with tag-specific antibodies

    • Examine cell fractions separately (membrane vs. cytosolic)

    • Test multiple growth and induction conditions

  • GET1-specific considerations:

    • Include N-terminal purification tags (C-terminal tags may interfere with TA insertion)

    • Design constructs with different length membrane spans

    • Consider expressing separate domains rather than full-length protein

What methods can detect protein-protein interactions between D. hansenii GET1 and its partners?

To detect protein-protein interactions between D. hansenii GET1 and its partners:

  • In vivo methods:

    • Split fluorescent protein complementation (BiFC) with GET1/GET2/GET3

    • FRET-based interaction assays using fluorescently tagged proteins

    • Yeast two-hybrid assay modified for membrane proteins

    • Co-immunoprecipitation with epitope-tagged GET1

  • In vitro methods:

    • Surface plasmon resonance to measure binding kinetics

    • Microscale thermophoresis for interaction studies in solution

    • Co-purification assays to identify stable complexes

    • Crosslinking mass spectrometry to map interaction interfaces

  • Salt-dependent interaction studies:

    • Compare interaction strength at different salt concentrations

    • Identify salt-stabilized interfaces unique to D. hansenii

    • Determine if high salt modifies GET1-GET3 release kinetics

  • Comparative analysis:

    • Study interactions of D. hansenii GET1 with both D. hansenii and S. cerevisiae partners

    • Identify species-specific interaction preferences

    • Map differences to adaptation for halotolerant environments

How should I interpret contradictory data on D. hansenii GET1 function in different experimental conditions?

When interpreting contradictory data on D. hansenii GET1 function:

  • Systematically analyze environmental variables:

    • Check if contradictions correlate with different salt concentrations

    • D. hansenii proteins often show distinct behavior at high salt (0.5-1.0M NaCl enhances activity)

    • Verify temperature conditions (optimal activity at 20-25°C rather than 37°C)

    • Compare pH conditions (activity peaks at pH 4.5 and below)

    • Check experiment duration (activity may drop within 3 hours at 37°C)

  • Evaluate genetic background effects:

    • Some D. hansenii isolates retain wild-type genes despite apparent disruption

    • Multiple gene copies may mask phenotypic effects

    • Verify strain genotypes through sequencing

  • Apply contradiction detection and resolution framework:

    • Classify contradictions as self-contradictory, pairwise, or conditional

    • Design targeted experiments to address specific contradiction types

    • Consider if contradictions reflect genuine biological complexity

  • Reconciliation strategies:

    • Develop unifying models that account for condition-dependent behavior

    • Consider evolutionary adaptations specific to D. hansenii's halotolerant lifestyle

    • Compare with orthologous systems in related yeasts

What statistics should I use when analyzing D. hansenii GET1 experimental data?

When analyzing D. hansenii GET1 experimental data:

What emerging technologies can advance D. hansenii GET1 research?

Emerging technologies with potential to advance D. hansenii GET1 research include:

  • Advanced genetic tools:

    • CRISPR CUG/Cas9 systems optimized for CUG clade yeasts

    • Base editing technologies for precise point mutations

    • In vivo DNA assembly for rapid strain construction

    • NHEJ-deficient strains for enhanced homologous recombination

  • Structural biology innovations:

    • Cryo-EM for membrane protein complexes in nanodiscs

    • Integrative structural biology combining multiple data sources

    • In-cell structural determination methods

    • Single-particle tracking to monitor GET1/2 dynamics in membranes

  • High-throughput functional assays:

    • Microfluidics platforms for measuring channel dynamics

    • Deep mutational scanning of GET1 function

    • Synthetic genetic arrays to map GET pathway interactions

    • Live-cell imaging of TA protein insertion in real-time

  • Computational approaches:

    • Molecular dynamics simulations in high-salt environments

    • Machine learning for predicting salt-stable protein variants

    • Systems biology models of the GET pathway

    • Contradictory data detection and resolution algorithms

How can holotomography be applied to study D. hansenii GET1 and membrane dynamics?

Holotomography offers powerful applications for studying D. hansenii GET1 and membrane dynamics:

  • Label-free visualization advantages:

    • Enables observation of native membrane structures without fluorescent tags

    • Allows tracking of physical parameters in living cells

    • Can visualize subcellular features like membranes and vacuoles

    • Permits long-term imaging without photobleaching or phototoxicity

  • Specific applications for GET1 research:

    • Monitor morphological changes in ER membranes in GET1 mutants

    • Track TA protein localization without fluorescent tags

    • Observe membrane dynamics under varying salt concentrations

    • Measure physical parameters of membranes in response to osmotic stress

  • Implementation methodology:

    • Optimize holotomography parameters for D. hansenii cells

    • Combine with fluorescent markers for correlative imaging

    • Develop quantitative analysis pipelines for membrane feature extraction

    • Use time-lapse holotomography to track dynamic processes

  • Integration with other technologies:

    • Correlative light-electron microscopy using holotomography as a bridge

    • Combine with super-resolution microscopy for multi-scale imaging

    • Integrate with microfluidics for controlled environmental changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.