Recombinant Debaryomyces hansenii Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET2; DEHA2B10626g; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
GET2
Target Protein Sequence
MSEQPLSQDEKRRLLRERRQAKMARGKASERLNNILSQGSSVKGTTDPVSVFDSKPEPTA SSTKPAEVSPAVSSHRDPEDDPDLMDIDNVTPEIKVDEPNIDKMLSDIFGANVGGNATDS SQDDFMANMMNMMKQGEGVDGSTGGTAEPQEPGYQSQLNAYNIYQQRLWKFRFSIIRFAA VLTNFFYHYLTIQDYSFTSSPHFYVRALAPHPAVNSFITWFSTCEVAILASFYLITSKNN IYANASDGNLLLKGISMGAMVLPQLRAYQPLVIRLAHYWEVFSMLLGDIFLVVVLFGLVS IYN
Uniprot No.

Target Background

Function
Recombinant *Debaryomyces hansenii* Golgi to ER traffic protein 2 (GET2) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET1, it functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of resident ER proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.
Database Links
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii GET2 and what is its primary function?

Debaryomyces hansenii GET2 (also known as Golgi to ER traffic protein 2) is a protein encoded by the GET2 gene (DEHA2B10626g) in the halotolerant yeast Debaryomyces hansenii. This protein functions as an essential component of the Guided Entry of Tail-anchored proteins (GET) pathway, which facilitates the post-translational insertion of tail-anchored proteins into the endoplasmic reticulum membrane. The full-length protein consists of 303 amino acids with specific domains that enable its functionality in membrane targeting and protein trafficking between cellular compartments .

D. hansenii itself is a hemiascomycetous yeast commonly found in natural substrates and various types of cheese. It has notable characteristics including halotolerance, which makes it well-suited for specific industrial bioprocesses . GET2's function in D. hansenii may be particularly significant given the organism's need to maintain proper protein trafficking under salt stress conditions.

What are the optimal storage and handling conditions for recombinant D. hansenii GET2?

Recombinant D. hansenii GET2 requires careful storage and handling to maintain its structural integrity and functional activity. Based on established protocols for similar recombinant proteins from D. hansenii, the following conditions are recommended:

  • Storage temperature: Store at -20°C for short-term storage or -80°C for extended storage periods.

  • Buffer composition: Maintain in Tris-based buffer with 50% glycerol, optimized for protein stability (pH 8.0).

  • Aliquoting: Divide the stock solution into small working aliquots to avoid repeated freeze-thaw cycles.

  • Working conditions: Keep working aliquots at 4°C for up to one week.

  • Freeze-thaw cycles: Repeated freezing and thawing should be strictly avoided as it leads to protein degradation and loss of activity .

For reconstitution of lyophilized protein:

  • Briefly centrifuge the vial before opening to bring contents to the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage at -20°C/-80°C .

What expression systems yield highest activity for recombinant D. hansenii GET2?

While E. coli has been successfully used as an expression system for various D. hansenii proteins, including the Solute carrier family 25 member 38 homolog , the optimal expression system for GET2 specifically may depend on research objectives. For structural and functional studies requiring post-translational modifications, yeast expression systems such as Pichia pastoris often provide better results than bacterial systems.

The choice of expression system should consider the following factors:

  • Expression yield requirements

  • Need for post-translational modifications

  • Downstream applications (structural studies vs. functional assays)

  • Tag selection (His-tag positioning affects protein folding and function)

Expression in E. coli can provide high yields but may lack proper folding for membrane-associated domains of GET2. Yeast expression systems better recapitulate the native environment for proper protein folding but may yield lower quantities.

How can GET2 knockout or mutations be used to study halotolerance in D. hansenii?

GET2 may play a role in D. hansenii's remarkable halotolerance, as protein trafficking is critical under salt stress conditions. Research approaches to investigate this connection include:

  • Generate GET2 knockout strains using CRISPR-Cas9 or traditional homologous recombination methods to assess phenotypic changes in salt tolerance.

  • Create point mutations targeting conserved residues to identify essential amino acids for functionality under salt stress.

  • Perform comparative growth analyses at varying salt concentrations between wild-type and GET2-modified strains.

  • Combine GET2 modifications with other salt tolerance gene modifications to investigate potential synergistic effects.

D. hansenii exhibits remarkable halotolerance through multiple mechanisms, including maintenance of ion homeostasis through transporters like DhNha1 (Na+/H+-antiporter), DhEna1 (Na+ secretion), and DhNhx1 and DhKha1 (H+/K+-antiporters) . The GET pathway may facilitate proper trafficking of these transporters to the appropriate cellular compartments, making GET2 indirectly involved in salt tolerance mechanisms.

What methods are most effective for studying GET2 interactions with partner proteins?

To investigate GET2 protein-protein interactions, researchers should consider these methodological approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged GET2 in D. hansenii

    • Purify protein complexes using affinity chromatography

    • Identify interacting partners via mass spectrometry

  • Yeast two-hybrid (Y2H) screening:

    • Use GET2 as bait to screen for interacting proteins

    • Validate interactions with co-immunoprecipitation

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse GET2 and potential interacting partners with complementary fragments of a fluorescent protein

    • Observe fluorescence restoration when proteins interact

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified GET2 on sensor chips

    • Measure binding kinetics with potential partners

The phosphoproteomic analysis approach used in D. hansenii studies for other proteins can also be adapted to identify GET2 phosphorylation states that may regulate its interactions under different conditions .

How should researchers interpret contradictory findings regarding GET2 localization in stress conditions?

Contradictory findings regarding GET2 localization under stress conditions may arise from:

  • Strain variations: Different D. hansenii strains may exhibit varying GET2 localization patterns. Always document the precise strain used (e.g., CBS 767, ATCC 36239) .

  • Experimental conditions: Growth conditions significantly affect protein expression and localization in D. hansenii. Consider these variables:

    • Growth phase (log vs. stationary)

    • Media composition (especially salt concentration)

    • Temperature and pH

    • Cultivation method (batch vs. continuous culture)

  • Detection methodology: Different localization techniques (immunofluorescence, GFP tagging) may yield varying results. Use multiple complementary approaches to validate findings.

  • Resolution limitations: Standard fluorescence microscopy may not distinguish between closely positioned membrane compartments. Consider super-resolution approaches for definitive localization.

When interpreting contradictory findings, construct a comprehensive experimental table that documents all variables across studies to identify potential sources of discrepancy:

VariableStudy AStudy BStudy C
D. hansenii strainCBS 767ATCC 36239CBS 767
Growth mediaYPDMinimalDefined salt media
Salt concentration1M NaClNone1M KCl
Growth phaseLogStationaryContinuous culture
Detection methodGFP taggingImmunofluorescenceFractionation
Growth temperature26°C30°C26°C

What analytical approaches are recommended for GET2 structure-function studies?

For comprehensive structure-function analysis of GET2, employ these analytical approaches:

  • Sequence-based analysis:

    • Multiple sequence alignment with GET2 homologs from other yeasts

    • Identification of conserved domains and motifs

    • Prediction of transmembrane regions and topology

  • Structural analysis:

    • X-ray crystallography of purified GET2 (challenging for membrane proteins)

    • Cryo-electron microscopy for GET complex structure

    • NMR spectroscopy for dynamic regions

  • Functional domain mapping:

    • Truncation series to identify minimal functional domains

    • Site-directed mutagenesis of conserved residues

    • Chimeric proteins with GET2 from non-halotolerant yeasts

  • Computational approaches:

    • Molecular dynamics simulations under varying salt conditions

    • Protein-protein docking with known GET pathway components

    • AlphaFold or similar AI-based structure prediction

When designing experiments, systematically vary one parameter at a time while maintaining others constant to establish clear structure-function relationships.

How might GET2 be involved in cross-talk between salt tolerance and oxidative stress pathways?

Recent research on D. hansenii has revealed unexpected connections between salt tolerance and oxidative stress response pathways . GET2's role in this cross-talk presents an intriguing area for investigation, particularly since:

  • Exposure to salt stress in D. hansenii increases intracellular reactive oxygen species (ROS) levels.

  • Transcription of genes related to osmotic changes appears to be regulated by H₂O₂.

  • Protein trafficking between cellular compartments may redirect stress response proteins.

To investigate GET2's potential role in this cross-talk, researchers should consider:

  • Monitoring GET2 expression and localization under both salt and oxidative stress conditions.

  • Assessing how GET2 knockout affects ROS levels during salt stress.

  • Identifying if GET2-dependent protein trafficking is altered during oxidative stress.

  • Examining whether oxidative modifications of GET2 affect its function during salt stress.

The study by Garcia-Neto et al. (2017) demonstrated that both salt exposure and oxidative stress triggering agents produced increases in intracellular ROS levels in D. hansenii . GET2 may play a critical role in trafficking proteins needed for both stress responses.

What methodological approaches are recommended for integrating GET2 studies into systems biology frameworks?

To integrate GET2 studies into broader systems biology frameworks:

  • Multi-omics integration approaches:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use chemostat cultivations in controlled bioreactors for reproducible conditions

    • Apply GET2 perturbations (knockout, overexpression) and measure system-wide effects

  • Network biology approaches:

    • Construct protein-protein interaction networks centered on GET2

    • Develop gene regulatory networks including GET2 and related genes

    • Use Weighted Gene Co-expression Network Analysis (WGCNA) to identify GET2-associated modules

  • Computational modeling:

    • Develop kinetic models of GET pathway functioning

    • Integrate GET2 into genome-scale metabolic models of D. hansenii

    • Use constraint-based modeling to predict system-wide effects of GET2 perturbations

  • Experimental design considerations:

    • Employ factorial designs testing multiple stress factors simultaneously

    • Use continuous cultivation methods (as in Navarrete et al.) to maintain steady-state conditions

    • Implement time-course experiments to capture dynamic responses

The integrative -omics study approach described for D. hansenii provides an excellent template for incorporating GET2 studies into systems biology frameworks . This involves performing chemostat cultivations in controlled bioreactors with precise stress conditions (e.g., 1M NaCl or KCl) and analyzing transcriptomic and phosphoproteomic profiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.