Recombinant Debaryomyces hansenii High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of SHO1

Recombinant Debaryomyces hansenii High Osmolarity Signaling Protein SHO1 (SHO1) is a transmembrane osmosensor involved in cellular adaptation to hyperosmotic stress. This protein is part of the High Osmolarity Glycerol (HOG) pathway, a conserved signaling system in fungi that regulates glycerol biosynthesis and ion homeostasis under osmotic stress . The recombinant form is expressed in E. coli with an N-terminal His tag for purification .

Key Molecular Features

PropertyDescription
UniProt IDQ6BVC2
Gene NameSHO1
SpeciesDebaryomyces hansenii (strain ATCC 36239 / CBS 767)
Amino Acid Sequence304 residues (MSFSISNFIGDPFAISTLSFGLIAWIISIAGAGASNQDKFPHFSWWGIMYQLVIMVV...)
Expression SystemE. coli
TagHis tag (N-terminal)
StorageTris-based buffer with 50% glycerol at -20°C/-80°C

Functional Role in Osmotic Stress Response

SHO1 acts as a sensor in the HOG pathway, detecting extracellular osmolarity changes and activating downstream MAP kinase cascades. In D. hansenii, this pathway is critical for surviving high-salt environments by upregulating glycerol synthesis (via DhGPD1 and DhSTL1) and maintaining ion balance . SHO1’s structural features, including transmembrane domains and a cytoplasmic SH3 domain, enable interaction with signaling components like Ste20 and Ste11 .

Production and Engineering

Recent advances in D. hansenii genetic tools, such as CRISPR-Cas9 and in vivo DNA assembly, have streamlined recombinant protein production . For SHO1:

  • Expression: Optimized in E. coli with codon adaptation for high yield .

  • Purification: Affinity chromatography using the His tag ensures >90% purity (verified by SDS-PAGE) .

  • Stability: Lyophilized formulations retain activity for long-term storage .

Applications in Industrial Biotechnology

D. hansenii’s halotolerance and robust recombinant protein production make it ideal for valorizing saline industrial waste. Examples include:

  • Dairy By-Product Utilization: D. hansenii grows in unsterilized, salt-rich whey while producing recombinant proteins like SHO1 or YFP .

  • Pharmaceutical Waste Revalorization: Engineered strains expressing SHO1 enhance osmotolerance, enabling growth in high-salt pharmaceutical effluents .

Research Gaps and Future Directions

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
SHO1; DEHA2C03806g; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
SHO1
Target Protein Sequence
MSFSISNFIGDPFAISTLSFGLIAWIISIAGAGASNQDKFPHFSWWGIMYQLVIMVVITV LYLYNTIELYKFTLVGLLSIAFVYSTNSTNHLIYKTGDSGMLCCAAGCILLSMLNLIWIL YFGGHPESPTNQFIDSFSLKTHSHNHGHLPSADNKAADGDIDDEVEYKRYSSSQGNTQFQ DNNLRQSQLTTNNKSVNTPYMSSSQLNGLENFSSSDVHQSRDLTSNKRQTVYNDTNSVND TGNVFRYKAKALYSYDANPEDINEISFAKDELLEVDDIDGKWWQAKRSNGQVGICPSNYV KLMD
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii and why is it significant for biotechnological applications?

Debaryomyces hansenii is an extremophilic yeast that possesses several advantageous characteristics making it an attractive target for biotechnological research. It is metabolically versatile, non-pathogenic, osmotolerant (able to grow in high-salt environments), and oleaginous (capable of accumulating significant amounts of lipids). These properties enable D. hansenii to grow in harsh environments that would inhibit other microorganisms, such as industrial by-products with high salt content from the dairy and pharmaceutical industries .

The biotechnological significance of D. hansenii extends to its applications in food manufacturing and potential for the heterologous synthesis of various fine chemicals. Its ability to grow in non-sterile conditions due to high salt tolerance provides a competitive advantage in industrial applications, reducing the need for expensive sterilization processes .

What is the role of the SHO1 protein in yeast osmoregulation?

SHO1 (High Osmolarity Signaling Protein 1) functions as an osmosensor in the HKR1 sub-branch of the High Osmolarity Glycerol (HOG) pathway. This four-transmembrane domain protein plays a critical role in detecting changes in external osmolarity and initiating cellular responses to maintain osmotic balance .

When yeast cells encounter high external osmolarity, SHO1 undergoes structural changes in its transmembrane domains, which enables it to bind to the cytoplasmic adaptor protein Ste50. This interaction triggers the Ste20–Ste11–Pbs2–Hog1 kinase cascade, ultimately leading to the activation of the Hog1 MAP kinase. Once activated, Hog1 coordinates the cellular adaptation to high osmolarity conditions through various mechanisms, including glycerol production and retention .

What structural features characterize the SHO1 protein?

SHO1 is characterized by four transmembrane (TM) domains that form a distinct oligomeric architecture. Specifically, SHO1 forms planar oligomers with a "dimers-of-trimers" structure through two distinct interfaces:

  • Dimerization occurs at the TM1/TM4 interface

  • Trimerization occurs at the TM2/TM3 interface

This complex structural arrangement serves two crucial functions:

  • Osmosensing Function: The transmembrane domains undergo conformational changes in response to high external osmolarity, which facilitates binding to the Ste50 adaptor protein and subsequent signal transduction.

  • Scaffolding Function: The SHO1 oligomer serves as a structural scaffold, binding to TM proteins Opy2 and Hkr1 at the TM1/TM4 and TM2/TM3 interfaces, respectively. This creates a multi-component signaling complex essential for Hog1 activation .

How can researchers efficiently express recombinant SHO1 in Debaryomyces hansenii?

For efficient expression of recombinant SHO1 in D. hansenii, researchers should utilize the recently developed PCR-based gene targeting methods combined with optimized promoter and terminator selections. The procedure involves several key steps:

  • Vector Construction: For optimal expression, use the TEF1 promoter from Arxula adeninivorans and the CYC1 terminator. These elements have been shown to provide the highest recombinant protein yields in D. hansenii .

  • Transformation Methodology: Implement the recently developed PCR-based amplification method that extends a heterologous selectable marker with 50 bp flanks identical to the target site in the genome. This approach has demonstrated homologous recombination at high frequency (>75%), allowing efficient integration of the SHO1 gene at specific genome locations .

  • In Vivo DNA Assembly: Take advantage of D. hansenii's capability for in vivo DNA assembly to streamline the generation of transformant strains. Up to three different DNA fragments containing 30-bp homologous overlapping overhangs can be co-transformed into the yeast and fused in the correct order in a single step .

  • Growth Medium Selection: For optimal expression, utilize salt-rich industrial by-products without supplementation. D. hansenii thrives in these conditions, which can simultaneously reduce cultivation costs and inhibit contaminating microorganisms .

  • Expression Verification: Monitor gene expression through RT-PCR and protein production through fluorescent tagging or other detection methods appropriate for the specific research goals .

What methodological approaches can be used to study SHO1 oligomerization and its impact on osmosensing in D. hansenii?

Studying SHO1 oligomerization and its impact on osmosensing in D. hansenii requires a multi-faceted experimental approach:

  • Crosslinking Studies: Implement chemical crosslinking followed by SDS-PAGE and Western blotting to identify oligomeric states of SHO1. This technique has previously demonstrated the dimers-of-trimers architecture in yeast SHO1 proteins .

  • Mutagenesis Analysis:

    • Create site-directed mutations at the TM1/TM4 interface to disrupt dimerization

    • Create site-directed mutations at the TM2/TM3 interface to disrupt trimerization

    • Evaluate the impact of these mutations on SHO1 function and Hog1 activation

  • Co-immunoprecipitation Assays: Use co-IP techniques to detect osmostress-induced binding between SHO1 and adaptor proteins like Ste50. This can be accomplished by:

    • Expressing epitope-tagged versions of SHO1 and potential binding partners

    • Exposing cells to osmotic stress conditions

    • Performing immunoprecipitation to detect protein-protein interactions

    • Analyzing the time course of these interactions (optimal detection around 10 minutes after osmotic stress induction)

  • Fluorescence Microscopy: Implement fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) to visualize SHO1 oligomerization in living cells under various osmotic conditions.

How does SHO1 function differ between Debaryomyces hansenii and Saccharomyces cerevisiae, and what are the experimental approaches to study these differences?

Comparing SHO1 function between D. hansenii and S. cerevisiae requires methodical analysis of protein structure, function, and regulation:

  • Sequence Analysis and Structure Prediction:

    • Perform comparative sequence analysis of SHO1 from both species

    • Use structural prediction tools to identify potential differences in transmembrane domain organization

    • Look specifically at the TM1/TM4 and TM2/TM3 interfaces involved in oligomerization

  • Heterologous Expression Studies:

    • Express D. hansenii SHO1 in S. cerevisiae sho1Δ mutants to test functional complementation

    • Conversely, express S. cerevisiae SHO1 in D. hansenii with SHO1 deletions

    • Analyze the ability of each protein to activate the HOG pathway in the heterologous host

  • Domain Swapping Experiments:

    • Create chimeric proteins containing domains from both D. hansenii and S. cerevisiae SHO1

    • Test the functionality of these chimeras to identify species-specific functional domains

  • Osmotolerance Assays:

    • Compare growth of wild-type and SHO1-modified strains under varying osmotic conditions

    • Measure glycerol production as an indicator of HOG pathway activation

    • Analyze the kinetics of Hog1 phosphorylation in response to osmotic stress

  • Protein-Protein Interaction Analysis:

    • Identify species-specific interaction partners using techniques such as yeast two-hybrid screening or mass spectrometry-based proteomics

    • Compare the binding affinities of SHO1 from both species to common interactors like Ste50

What techniques can be used to monitor SHO1-mediated HOG pathway activation in D. hansenii?

Monitoring SHO1-mediated HOG pathway activation in D. hansenii can be accomplished through several complementary techniques:

  • Hog1 Phosphorylation Analysis:

    • Use Western blotting with phospho-specific antibodies to detect activated (phosphorylated) Hog1

    • Perform time-course experiments following osmotic stress to determine activation kinetics

    • Compare wild-type strains with SHO1 mutants to establish the contribution of SHO1 to Hog1 activation

  • Transcriptional Reporter Systems:

    • Construct reporter plasmids containing Hog1-responsive promoters (e.g., GPD1, STL1) fused to reporter genes (GFP, YFP, or luciferase)

    • Monitor reporter gene expression following osmotic stress in various genetic backgrounds

    • Use the recently developed PCR-based gene targeting method to integrate these reporters into the D. hansenii genome

  • Glycerol Content Measurement:

    • Quantify intracellular and extracellular glycerol levels using enzymatic assays or HPLC

    • Compare glycerol production kinetics between wild-type and SHO1 mutant strains

    • Correlate glycerol production with Hog1 activation and cell survival under osmotic stress

  • Real-time Microscopy:

    • Express fluorescently tagged Hog1 to monitor its nuclear translocation in response to osmotic stress

    • Combine with fluorescently tagged SHO1 to simultaneously track both proteins during osmotic response

  • Protein-Protein Interaction Dynamics:

    • Use co-immunoprecipitation or proximity ligation assays to track SHO1 interactions with other HOG pathway components

    • Monitor the formation of the multi-component signaling complex involving SHO1, Opy2, and Hkr1 under varying osmotic conditions

How can researchers develop and optimize a CRISPR-Cas9 system for SHO1 modification in D. hansenii?

Developing and optimizing a CRISPR-Cas9 system for SHO1 modification in D. hansenii requires careful consideration of several factors:

  • Guide RNA Design:

    • Analyze the D. hansenii SHO1 gene sequence to identify suitable target sites

    • Design guide RNAs with minimal off-target effects using specialized software

    • Consider the GC content and secondary structure of potential guide RNAs

    • Target specific domains (TM1/TM4 or TM2/TM3 interfaces) for functional studies

  • Cas9 Expression Optimization:

    • Select appropriate promoters for Cas9 expression in D. hansenii (TEF1 promoter has shown good results for heterologous protein expression)

    • Consider codon optimization of Cas9 for enhanced expression in D. hansenii

    • Use appropriate terminators (CYC1 has demonstrated effectiveness)

  • Delivery Methods:

    • Optimize transformation protocols for ribonucleoprotein (RNP) complex delivery

    • Alternatively, deliver Cas9 and guide RNA expression cassettes on plasmids

    • Utilize homologous recombination for precise gene editing by providing repair templates with homology arms (~50 bp) flanking the target site

  • Screening and Verification:

    • Develop efficient screening methods to identify successful editing events

    • Implement PCR-based genotyping, restriction enzyme digests, or sequencing

    • Verify phenotypic changes through functional assays for osmotic stress response

  • Off-target Analysis:

    • Sequence potential off-target sites predicted by bioinformatic tools

    • Perform whole-genome sequencing of edited strains to identify any unintended modifications

What experimental design would effectively study the role of SHO1 in industrial salt-rich environments using D. hansenii?

To effectively study the role of SHO1 in industrial salt-rich environments using D. hansenii, the following experimental design is recommended:

  • Strain Engineering:

    • Generate a series of D. hansenii strains with:

      • Wild-type SHO1

      • SHO1 deletion

      • SHO1 with mutations in key functional domains (TM1/TM4 and TM2/TM3 interfaces)

      • SHO1 with fluorescent tags for localization studies

  • Growth Characterization in Industrial By-products:

    • Culture each strain in various salt-rich industrial by-products from dairy and pharmaceutical industries

    • Monitor growth parameters (lag phase, growth rate, final biomass)

    • Assess cell viability using flow cytometry with appropriate viability stains

    • Create a comprehensive growth profile table comparing strain performance across different substrates

  • Recombinant Protein Production Assessment:

    • Express a model recombinant protein (such as YFP) in each strain

    • Quantify protein production levels under different salt concentrations

    • Analyze the impact of SHO1 mutations on recombinant protein yield

    • Determine optimal conditions for industrial applications

  • Metabolic Analysis:

    • Perform metabolomic profiling of strains under various osmotic conditions

    • Focus on carboxylate transport, as D. hansenii possesses transporters for acetate, succinate, and malate

    • Measure glycerol production as an indicator of HOG pathway activation

    • Correlate metabolic adjustments with SHO1 function

  • Transcriptomic Response:

    • Implement RNA-seq to analyze the global transcriptional response to salt stress

    • Compare wild-type and SHO1 mutant transcriptomes to identify SHO1-dependent gene expression

    • Focus on genes involved in osmoadaptation and recombinant protein production

  • Scale-up Studies:

    • Progress from laboratory-scale (1.5 mL) to pilot-scale (1 L) fermentations

    • Assess the consistency of SHO1 function across scales

    • Evaluate the performance of engineered strains in non-sterile conditions that mimic industrial settings

How should researchers interpret contrasting data between predicted and observed SHO1 function in D. hansenii?

When faced with discrepancies between predicted and observed SHO1 function in D. hansenii, researchers should follow a systematic approach to data analysis and interpretation:

  • Verification of Experimental Methods:

    • Re-examine experimental conditions and controls to confirm technical accuracy

    • Replicate key experiments with alternative methodologies to validate findings

    • Consider whether experimental conditions might influence protein function in unexpected ways

  • Sequence and Structural Analysis:

    • Compare the primary sequences of SHO1 between D. hansenii and model organisms

    • Analyze predicted protein structures to identify potential functional differences

    • Examine post-translational modifications that might not be predicted by sequence analysis alone

  • Functional Domain Investigation:

    • Conduct targeted mutagenesis of specific domains to identify critical residues

    • Use domain swapping between D. hansenii SHO1 and homologs from other species

    • Examine whether D. hansenii SHO1 might have evolved additional or modified functions

  • Interactome Analysis:

    • Identify and compare SHO1 interaction partners between D. hansenii and model organisms

    • Consider whether novel protein-protein interactions might explain functional differences

    • Analyze whether the SHO1 scaffolding function might differ in D. hansenii

  • Evolutionary Context:

    • Place observations in an evolutionary context, considering D. hansenii's adaptation to high-salt environments

    • Compare SHO1 function across multiple yeasts with varying osmotolerance

    • Consider whether functional divergence might represent adaptive evolution

  • Integration with Systems Biology Data:

    • Incorporate transcriptomic, proteomic, and metabolomic data to develop a holistic view

    • Use computational modeling to predict system behavior under various conditions

    • Identify potential compensatory mechanisms that might mask SHO1 function

What statistical approaches are most appropriate for analyzing SHO1-mediated stress response data in D. hansenii?

Analysis of SHO1-mediated stress response data in D. hansenii requires careful statistical consideration:

  • Experimental Design Statistics:

    • Power analysis to determine appropriate sample sizes

    • Randomized block designs to control for batch effects in fermentation studies

    • Factorial designs to examine interactions between SHO1 modifications and environmental conditions

  • Time Series Analysis:

    • Mixed-effects models for repeated measures in time-course experiments

    • Functional data analysis for continuous monitoring of growth or reporter gene expression

    • Change-point detection to identify critical transitions in stress response

  • Multivariate Analysis:

    • Principal Component Analysis (PCA) to identify patterns in high-dimensional datasets

    • Partial Least Squares (PLS) regression to relate SHO1 structure to functional outcomes

    • Cluster analysis to identify genes with similar expression patterns in response to osmotic stress

  • Comparative Statistical Methods:

    • ANOVA with appropriate post-hoc tests for comparing multiple strains or conditions

    • Non-parametric alternatives when data violate normality assumptions

    • Specialized methods for comparing growth curves, such as growth curve fitting and parameter extraction

  • Bioinformatic Statistical Approaches:

    • Enrichment analysis for transcriptomic and proteomic data

    • Network statistics for protein-protein interaction networks

    • Bayesian methods for integrating diverse data types

  • Data Visualization Statistics:

    • Heatmaps with hierarchical clustering for visualizing complex datasets

    • Three-dimensional plots for examining interactions between multiple variables

    • Statistical methods for quantifying uncertainties in visualizations

How can researchers differentiate between SHO1-dependent and SHO1-independent osmoadaptation mechanisms in D. hansenii?

To differentiate between SHO1-dependent and SHO1-independent osmoadaptation mechanisms in D. hansenii, researchers should implement a comprehensive experimental strategy:

  • Genetic Approach:

    • Generate clean SHO1 deletion strains using the efficient PCR-based gene targeting method

    • Create strains with specific mutations in SHO1 functional domains

    • Develop double mutants affecting both SHO1 and components of alternative osmosensing pathways

    • Compare phenotypes of these strains under various osmotic conditions

  • Pathway-Specific Reporters:

    • Develop reporter systems for SHO1-dependent and alternative osmoadaptation pathways

    • Monitor pathway activation in response to different osmotic challenges

    • Analyze the kinetics of activation to identify primary and secondary response mechanisms

  • Biochemical Approach:

    • Measure the activation (phosphorylation) of Hog1 and other MAP kinases

    • Analyze the accumulation of compatible solutes (glycerol, trehalose) in response to osmotic stress

    • Compare metabolic profiles between wild-type and SHO1 mutant strains

  • Transcriptomic Analysis:

    • Perform RNA-seq under various osmotic conditions in wild-type and SHO1 mutant strains

    • Identify genes whose expression is:

      • SHO1-dependent (altered in SHO1 mutants)

      • SHO1-independent (unaffected in SHO1 mutants)

      • Partially SHO1-dependent (moderately affected in SHO1 mutants)

    • Use clustering approaches to group genes with similar expression patterns

  • Epistasis Analysis:

    • Construct strains with mutations in multiple osmosensing components

    • Analyze phenotypes to determine pathway relationships (parallel, series, or redundant)

    • Use genetic suppressor screens to identify components that can bypass SHO1 function

How can understanding SHO1 function contribute to improving D. hansenii as a cell factory for industrial applications?

Understanding SHO1 function can significantly enhance D. hansenii's utility as an industrial cell factory through several strategic applications:

  • Strain Engineering for Enhanced Osmotolerance:

    • Modify SHO1 to optimize osmotic stress response for specific industrial environments

    • Engineer strains with constitutively active SHO1 for enhanced performance in high-salt conditions

    • Develop SHO1 variants that provide osmotolerance without growth penalties

  • Bioprocess Optimization:

    • Adjust fermentation parameters based on understanding of SHO1-mediated stress responses

    • Implement controlled stress induction to enhance product yield through SHO1 pathway activation

    • Design media compositions that leverage SHO1 function for optimal cell performance

  • Valorization of Complex Industrial By-products:

    • Utilize SHO1-engineered strains for efficient growth on salt-rich dairy and pharmaceutical by-products

    • Develop processes that use these otherwise problematic waste streams as substrates

    • Reduce process costs by eliminating the need for freshwater and nutritional supplements

  • Product Yield Improvement:

    • Engineer the SHO1 pathway to redirect carbon flux toward desired products

    • Develop strains with modified SHO1 signaling to enhance recombinant protein production

    • Combine SHO1 engineering with optimized promoters (TEF1) and terminators (CYC1) for maximum yield

  • Process Robustness Enhancement:

    • Develop strains with engineered SHO1 pathways that provide resistance to multiple stresses

    • Create production systems that operate reliably in non-sterile conditions

    • Improve strain stability during long-term continuous processing

What methodological considerations are important when studying SHO1 function in combination with carboxylate transport in D. hansenii?

When investigating SHO1 function in combination with carboxylate transport in D. hansenii, researchers should consider several methodological aspects:

  • Transport Assay Design:

    • Implement radiolabeled substrate uptake assays to quantify transport kinetics

    • Develop fluorescent substrate analogs for real-time transport visualization

    • Design competition assays to determine transporter specificity

    • Consider the kinetic parameters of the four characterized carboxylate transporters (for acetate, malate, and succinate)

  • Gene Expression Coordination Analysis:

    • Perform simultaneous RT-PCR or RNA-seq to monitor expression of both SHO1 and transporter genes (DHJEN)

    • Analyze expression patterns across various carbon sources and osmotic conditions

    • Determine whether SHO1 activation influences transporter gene expression

  • Protein-Protein Interaction Studies:

    • Investigate potential physical interactions between SHO1 and carboxylate transporters

    • Examine whether SHO1 scaffolding function extends to organizing transporter complexes

    • Use co-immunoprecipitation and proximity ligation assays to detect interactions

  • Metabolic Flux Analysis:

    • Employ isotope-labeled substrates to track carboxylate metabolism

    • Compare flux patterns between wild-type and SHO1 mutant strains

    • Determine how osmotic stress impacts carboxylate utilization

  • Physiological Response Integration:

    • Design experiments that simultaneously challenge cells with osmotic stress and altered carboxylate availability

    • Monitor growth, stress response, and transport activity in parallel

    • Develop mathematical models that integrate both regulatory systems

  • Genetic Manipulation Strategy:

    • Create strains with modifications in both SHO1 and specific carboxylate transporters

    • Use the efficient PCR-based gene targeting method for precise genetic modifications

    • Implement in vivo DNA assembly for rapid construction of multiple variant strains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.