Recombinant Debaryomyces hansenii Mitochondrial import inner membrane translocase subunit TIM14 (PAM18)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Debaryomyces hansenii Mitochondrial Import Inner Membrane Translocase Subunit TIM14 (PAM18)

Recombinant Debaryomyces hansenii Mitochondrial Import Inner Membrane Translocase Subunit TIM14, also known as PAM18, is a recombinant protein derived from the yeast Debaryomyces hansenii. This protein plays a crucial role in the mitochondrial import process, specifically within the inner membrane translocase complex. TIM14/PAM18 is essential for the efficient translocation of proteins from the inner membrane into the mitochondrial matrix, a process that is ATP-dependent and involves the stimulation of mtHSP70 (SSC1) activity .

Function and Role in Mitochondrial Protein Import

TIM14/PAM18 is a component of the PAM complex, which is vital for the translocation of proteins across the mitochondrial inner membrane. This complex works in conjunction with other translocases, such as TIM23, to ensure the proper targeting and insertion of mitochondrial proteins. The interaction between PAM18 and mtHSP70 is critical for the ATP-dependent unfolding and translocation of proteins into the mitochondrial matrix .

Properties and Characteristics

  • Species: The protein is derived from Debaryomyces hansenii, a yeast species known for its halotolerance and probiotic properties .

  • UniProt Number: Q6BH37.

  • Tag Information: The tag type is determined during the production process.

  • Storage Buffer: Tris-based buffer with 50% glycerol.

  • Storage Conditions: Store at -20°C or -80°C for extended periods. Avoid repeated freezing and thawing .

  • Amino Acid Sequence: The sequence includes 172 amino acids, starting with MAPFNMDIPTLAIPGDRNQSQAIELSQQAQQPQQPQQSQQAYTGHLQRKQADEGSAEYYFDKGCEWMGNHPWMTGMGVLGVAYFASGFVKSKQPGINGKAFVKGPFGQKMTPKEALQILNLKETNLSQAKLKEQHRKLMMANHPDKGGSSYLATKVNEAKDILEKRGGLKKK .

Research Findings and Applications

Research on TIM14/PAM18 has primarily focused on its role in mitochondrial protein import and its interaction with other components of the PAM complex. The protein's ability to stimulate mtHSP70 activity is crucial for efficient protein translocation into the mitochondrial matrix. Studies using Debaryomyces hansenii have also explored the organism's potential as a probiotic and its effects on gut health and immune modulation .

Table 1: Properties of Recombinant Debaryomyces hansenii TIM14 (PAM18)

PropertyDescription
SpeciesDebaryomyces hansenii
UniProt NumberQ6BH37
Tag TypeDetermined during production
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C
Amino Acid Sequence Length172 amino acids

Table 2: Functional Partners of TIM14/PAM18

ProteinFunction
PAM16Essential component of the PAM complex, regulates mtHSP70 activity via interaction with PAM18/TIM14 .
TIM44Essential component of the PAM complex, involved in ATP-dependent protein translocation .
TIM23Mediates translocation of proteins across the mitochondrial inner membrane .
mtHSP70 (SSC1)ATPase involved in protein translocation into the mitochondrial matrix .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To prioritize a specific tag, please specify it in your order.
Synonyms
PAM18; TIM14; DEHA2G21648g; Mitochondrial import inner membrane translocase subunit TIM14; Presequence translocated-associated motor subunit PAM18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
PAM18
Target Protein Sequence
MAPFNMDIPTLAIPGDRNQSQAIELSQQAQQPQQPQQSQQAYTGHLQRKQADEGSAEYYF DKGCEWMGNHPWMTGMGVLGVAYFASGFVKSKQPGINGKAFVKGPFGQKMTPKEALQILN LKETNLSQAKLKEQHRKLMMANHPDKGGSSYLATKVNEAKDILEKRGGLKKK
Uniprot No.

Target Background

Function

Recombinant Debaryomyces hansenii Mitochondrial Import Inner Membrane Translocase Subunit TIM14 (PAM18) is an essential component of the preprotein translocase of the inner mitochondrial membrane (PAM) complex. This complex is crucial for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane into the mitochondrial matrix. Within the PAM complex, TIM14/PAM18 plays a vital role in stimulating the activity of mitochondrial heat shock protein 70 (mtHSP70, also known as SSC1).

Database Links
Protein Families
TIM14 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is TIM14/PAM18 and what role does it play in mitochondrial protein import?

TIM14/PAM18 is an essential component of the mitochondrial import motor of the TIM23 translocase. It functions as a J-domain protein that stimulates the ATPase activity of mitochondrial Hsp70 (mtHsp70), enabling efficient protein translocation into the mitochondrial matrix. TIM14 is anchored in the inner mitochondrial membrane with its J-domain exposed to the matrix space . The protein is critical for the import of preproteins that require the action of mtHsp70, particularly those with an N-terminal matrix-targeting signal . Deletion or depletion of Tim14 results in severe defects in mitochondrial protein import, demonstrating its essential role in this process .

The PAM complex, which includes TIM14/PAM18, powers the release of imported proteins into the matrix through ATP hydrolysis via Hsp70. This complex consists of several proteins including Tim44, Tim15, Pam16, Pam18, Mge1, and Hsp70 . Within this machinery, TIM14/PAM18 activates mtHsp70, enabling it to function rapidly and in a regulated manner in the Tim44-mediated trapping of unfolded preproteins entering the matrix .

How does TIM14/PAM18 interact with other components of the mitochondrial import machinery?

TIM14/PAM18 forms specific interactions with multiple components of the TIM23 translocase complex:

  • Interaction with Tim44 and mtHsp70: TIM14 interacts with Tim44 and mtHsp70 in an ATP-dependent manner. These interactions are crucial for the functioning of the import motor .

  • Complex formation with Tim16: TIM14 forms a heterodimer with Tim16 (also known as Pam16), a J-like protein lacking the HPD motif. This interaction stimulates the activity of TIM14 .

  • Association with the TIM23 complex: Co-immunoprecipitation experiments have revealed that TIM14 is physically associated with the TIM23 complex. Antibodies against Tim17 and Tim23 efficiently co-precipitate TIM14, along with Tim50 and Tim44 .

  • Recruitment mechanism: Evidence suggests that Tim14 is recruited to the Tim17·Tim23 subcomplex by Tim44. In mitochondria depleted of Tim44, only minor amounts of Tim14 were co-precipitated with antibodies against Tim17 and Tim23 .

What is the functional significance of the TIM14-TIM16 complex?

The TIM14-TIM16 complex represents a critical regulatory unit within the mitochondrial import motor. Crystal structure analysis reveals that the conserved domains of these two proteins have virtually identical folds despite limited sequence similarity . This structural arrangement has significant functional implications:

  • Regulatory mechanism: Tim16 (Pam16) lacks the HPD motif necessary for stimulating Hsp70 ATPase activity but forms a heterodimer with Pam18 and in doing so, stimulates the activity of Pam18 .

  • Essential nature: Both Pam16 and Pam18 are essential for yeast viability, indicating their crucial role in mitochondrial function .

  • Domain requirements: Truncation mutant studies indicate that the conserved matrix domain of Tim14, which includes the J-domain and approximately 10 additional residues at its N-terminal side, is sufficient to support growth of yeast cells in the absence of wild-type protein .

  • N-terminal domain function: Interestingly, deletion of the N-terminal segment of Tim14, which extends into the intermembrane space in yeast, had virtually no effect on its function, despite suggestions that this domain might be essential for recruiting the import motor to the membrane-embedded part of the TIM23 translocase .

How does TIM14/PAM18 localization differ in plants compared to other eukaryotes?

Plants exhibit unique characteristics regarding the localization of TIM14/PAM18 homologs:

  • Multiple orthologs: Plants contain multiple copies of Pam16 and Pam18 genes, suggesting functional specialization or redundancy .

  • Dual targeting: While Pam16 orthologs (Pam16-1 and Pam16-2) are exclusively targeted to mitochondria, Pam18 orthologs (Pam18-1, Pam18-2, and Pam18-3) can be dual-targeted to both mitochondria and plastids, depending on the methodology used and tissue types investigated .

  • Tissue-specific localization: The localization pattern of Pam18 orthologs varies based on experimental approaches and tissue types:

ProteinBiolistic TransformationStable Transgenic GFP LinesNative PromoterIn vitro Import
Pam18-1Plastids onlyMitochondria and plastidsMitochondria and plastidsMitochondria and plastids
Pam18-2Mitochondria and plastidsMitochondria onlyNot testedMitochondria and plastids
Pam18-3Mitochondria and plastidsMitochondria and plastidsMitochondria onlyNot specified

This dual targeting capability suggests a possible role for Pam18 co-chaperones in plastids, representing an evolutionary adaptation specific to plants.

What are the effects of TIM14 depletion on mitochondrial protein import?

Depletion of TIM14 has profound effects on mitochondrial protein import processes:

  • General import defects: Mitochondria isolated from cells depleted of Tim14 showed strong defects in the import of most precursors using the TIM23 translocase pathway .

  • Selective impact: Interestingly, the only precursors of the TIM23 translocase that were not significantly affected were those which do not need a functional mitochondrial import motor . This selective impact highlights the specific role of TIM14 in the motor function of the import machinery.

  • Complex integrity: In Tim14-depleted mitochondria, antibodies against Tim17 and Tim23 were still able to pull down the Tim17·Tim23·Tim50 subcomplex together with Tim44, with a similar efficiency to wild-type mitochondria . This suggests that while TIM14 is a component of the TIM23 translocase, it is not required for the structural integrity of the core complex.

  • Functional consequences: The depletion studies indicate that Tim14 is required for the efficient binding of mtHsp70 to incoming polypeptide chains and for release from Tim44 , highlighting its crucial role in the dynamic process of protein translocation.

What expression systems are suitable for producing recombinant TIM14/PAM18?

Based on the available information, E. coli serves as an effective expression system for recombinant TIM14/PAM18 production:

  • E. coli expression: Recombinant full-length Debaryomyces hansenii TIM14/PAM18 protein has been successfully expressed in E. coli with an N-terminal His tag .

  • Protein properties: The recombinant protein typically includes the full-length sequence (172 amino acids) and can be produced with high purity (>90% as determined by SDS-PAGE) .

  • Storage and handling: The recombinant protein is often supplied as a lyophilized powder that should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended. Repeated freeze-thaw cycles should be avoided .

  • Buffer conditions: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been successfully used as a storage buffer for the recombinant protein .

What experimental approaches can be used to study TIM14/PAM18 localization and function?

Several complementary approaches have been used to study the localization and function of TIM14/PAM18:

  • In vitro protein import assays: This technique uses isolated organelles (mitochondria or plastids) to assess the import capability of proteins. For TIM14/PAM18, this approach has confirmed that Pam18 orthologs can be imported into both mitochondria and plastids .

  • Transient biolistic transformation: This method involves introducing GFP-tagged constructs into cell suspensions and observing protein localization. This technique has been used to demonstrate the dual targeting of some Pam18 orthologs .

  • Stable transgenic GFP-tagged lines: Creating stable transgenic plants expressing GFP-tagged proteins provides a more physiological context for studying protein localization. Both 35S promoter and native promoter constructs have been used to study TIM14/PAM18 targeting .

  • Co-immunoprecipitation: This technique has been valuable for identifying interactions between TIM14 and other components of the TIM23 complex. Antibodies against Tim17 and Tim23 have successfully co-precipitated Tim14, Tim50, and Tim44 .

  • Depletion studies: Selective depletion of TIM14 or other components of the import machinery in yeast has provided insights into their functional roles and interdependencies .

How can researchers assess the functional importance of specific domains in TIM14/PAM18?

Several experimental approaches have been employed to determine the functional significance of different TIM14/PAM18 domains:

  • Truncation mutants: Creation of mutants lacking specific domains (e.g., the intermembrane space domain or the transmembrane domain) has helped identify the minimum functional unit of TIM14. Studies have shown that even a mutant containing only the conserved matrix domain was able to support growth of cells and functionally replace wild-type Tim14 .

  • Site-directed mutagenesis: Mutations in specific motifs, such as the HPD motif in the J-domain, have demonstrated their essential role in TIM14 function. A mutation in the HPD motif of the J-domain is lethal, confirming its critical importance .

  • Growth assays: Testing the ability of mutant versions of TIM14 to support growth of yeast cells in the absence of wild-type protein has been valuable for assessing functional importance. This approach has shown that deletion of the N-terminal segment of Tim14 had virtually no effect on its function in yeast .

  • In vitro import assays with isolated mitochondria: This approach allows researchers to directly assess the impact of TIM14 modifications on protein import efficiency. Mitochondria isolated from cells depleted of Tim14 showed strong defects in the import of most precursors using the TIM23 translocase pathway .

What is known about the crystal structure of the TIM14-TIM16 complex?

The crystal structure of the TIM14-TIM16 complex provides important insights into its molecular architecture and function:

  • Structural similarity: Despite limited sequence similarity, the conserved domains of Tim14 and Tim16 have virtually identical folds .

  • Crystallization conditions: The complex has been crystallized in different space groups:

    • P2₁2₁2₁ for the Tim14-Tim16 complex

    • P4₃2₁2 for the Tim14-Tim16-K₂OsCl₆ complex

  • Cell constants: For the P2₁2₁2₁ space group, cell constants of a=112 Å, b=115 Å were reported, though the c value is partially cut off in the available information .

  • Functional implications: The structural analysis suggests that Tim16 (Pam16) regulates the activity of Tim14 (Pam18) through direct interaction, forming a heterodimeric regulatory unit within the import motor.

How do ATP-dependent interactions contribute to TIM14/PAM18 function?

ATP plays a crucial role in regulating the interactions and function of TIM14/PAM18 within the mitochondrial import motor:

  • Tim14-Tim44-mtHsp70 interactions: Tim14 interacts with Tim44 and mtHsp70 in an ATP-dependent manner . These interactions are essential for the proper functioning of the import motor.

  • Regulation of mtHsp70: Tim14 is required for the activation of mtHsp70, enabling this chaperone to act in a rapid and regulated manner in the Tim44-mediated trapping of unfolded preproteins entering the matrix .

  • J-domain function: The J-domain of Tim14, with its essential HPD motif, is crucial for stimulating the ATPase activity of Hsp70 . This stimulation drives the ATP-dependent cycle of binding and release that powers protein translocation.

  • ATP hydrolysis mechanism: The release of proteins into the matrix is powered by ATP hydrolysis via Hsp70 in the PAM complex, which consists of proteins Tim44, Tim15, Pam16, Pam18, Mge1, and Hsp70 .

How conserved is TIM14/PAM18 across different species?

TIM14/PAM18 shows significant conservation across eukaryotes, though with some notable variations:

  • Evolutionary conservation: TIM14 genes are present in the genomes of virtually all eukaryotes, indicating their fundamental importance in mitochondrial function .

  • Structural conservation: The J-domain and its crucial HPD motif are highly conserved, reflecting their essential functional role in protein import .

  • Species-specific variations: While the core function is conserved, there are species-specific adaptations. For example:

    • Yeast Tim14 has an N-terminal domain extending into the intermembrane space that is dispensable for function

    • Plants have multiple Pam18 orthologs with varying localization patterns

  • Dual targeting in plants: The ability of plant Pam18 orthologs to target both mitochondria and plastids represents an evolutionary adaptation specific to plants, possibly related to the presence of two endosymbiotic organelles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.