Recombinant Debaryomyces hansenii Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
TIM22; DEHA2D03872g; Mitochondrial import inner membrane translocase subunit TIM22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
TIM22
Target Protein Sequence
MAFGVYKVPEEQKTYAQMTPQEQAEEGAKKMVELMQSCPGKTVMAGVSGFFLGGFFGLFM ASMSYDVPIGTNAVSNIRDLPFKQQMKLQFSDMGKRTYSSAKNFGYIGMVYSGVECAIES LRAKHDIYNGVSAGCITGGGLAIRAGPQAALVGCAGFAAFSTAIDLYLRSDSASPPKNDY DE
Uniprot No.

Target Background

Function

Recombinant Debaryomyces hansenii Mitochondrial Import Inner Membrane Translocase Subunit TIM22 (TIM22) is an essential core component of the TIM22 complex. This complex facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Within the TIM22 complex, TIM22 functions as a voltage-activated and signal-gated channel, forming a twin-pore translocase that utilizes the membrane potential as an external driving force in two voltage-dependent steps.

Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii and why is it suitable for recombinant protein production?

Debaryomyces hansenii is a salt-tolerant yeast species with exceptional ability to grow in high-salt environments that inhibit most other microorganisms. This unique characteristic makes it particularly valuable for non-sterile cultivation systems using industrial side-streams with high salt content, such as dairy by-products. The yeast can be directly inoculated into these by-products without requiring fresh water, nutritional supplements, or sterile conditions, as the salt concentration naturally prevents contamination while enhancing D. hansenii's metabolism .

Research demonstrates that D. hansenii can successfully produce recombinant proteins like Yellow Fluorescent Protein (YFP) directly from industrial salty by-products. This capability serves dual purposes: demonstrating the yeast's ability to produce recombinant proteins from these waste streams and providing a convenient fluorescence-based method for specifically monitoring D. hansenii growth in mixed cultures .

What is the function of TIM22 in Debaryomyces hansenii mitochondria?

TIM22 in D. hansenii serves as an essential core component of the TIM22 complex, which mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Within this complex, TIM22 forms the voltage-activated and signal-gated channel that facilitates protein translocation. According to structural studies, TIM22 constitutes a twin-pore translocase that utilizes the membrane potential as an external driving force in two voltage-dependent steps .

The TIM22 complex represents a distinct mitochondrial import pathway separate from the TIM23 pathway, with each system handling different substrate classes. Research using chemical inhibitors like MitoBloCK-1 has demonstrated that the TIM22 pathway specifically mediates the import of carrier proteins including the ADP/ATP carrier, phosphate carrier, Tim22 itself, and Tafazzin, but not proteins that utilize the TIM23 or Mia40/Erv1 translocation pathways .

What are the key partners of TIM22 in the mitochondrial import machinery?

The TIM22 import pathway comprises several interacting components that work together to ensure proper translocation of substrate proteins. The key functional partners of TIM22 include:

ProteinFunctionInteraction Score with TIM22
TIM9Mitochondrial intermembrane chaperone that participates in import and insertion of multi-pass transmembrane proteins; guides hydrophobic precursors through the intermembrane space0.992
TIM10Functions similarly to TIM9 as an intermembrane chaperone; forms the Tim9-Tim10 complex0.955
TIM54Essential component of the TIM22 complex involved in mediating import and insertionNot specified

These components form two primary intermembrane space chaperone complexes: the Tim9-Tim10 complex and the Tim8-Tim13 complex. The Tim9-Tim10 complex specifically binds to substrate proteins during early stages of translocation when the substrate is crossing the outer membrane .

How does the Tim9-Tim10 complex influence substrate specificity in the TIM22 pathway?

The Tim9-Tim10 complex plays a crucial role in determining which proteins are imported via the TIM22 pathway. Research using the chemical inhibitor MitoBloCK-1 has revealed that this complex mediates the import of only a subset of inner membrane proteins. When MitoBloCK-1 impedes binding of the Tim9-Tim10 complex to substrate proteins during early translocation stages, the import of specific proteins is affected, including:

  • Carrier proteins (ADP/ATP carrier, phosphate carrier)

  • Tim22 itself

  • Tafazzin

Importantly, the import of Tim23 remains unaffected by disruption of the Tim9-Tim10 complex, indicating that the substrate specificity of this chaperone complex extends to some but not all inner membrane proteins .

What experimental approaches can be used to express recombinant proteins in D. hansenii?

When expressing recombinant proteins in D. hansenii, researchers can employ several methodological approaches:

Transformation and Expression System:

  • Linear plasmid cassettes containing the gene of interest (e.g., YFP) under control of constitutive promoters like TEF1 can be used to transform D. hansenii strains.

  • For optimal expression, genes should be codon-optimized for D. hansenii .

Culture Conditions for Recombinant Protein Expression:

  • Preculture preparation: Streak D. hansenii from glycerol stocks onto YPD plates (1% yeast extract, 2% peptone, 2% agar, 2% glucose) and incubate at 28°C for 48 hours.

  • Liquid precultures: Use synthetic complete Yeast Nitrogen Base (YNB) medium (6.7 g/L) with 2% glucose, pH adjusted to 6.0 with NaOH, in baffled flasks at 28°C, 150 rpm for 24 hours.

  • For industrial side-stream utilization: Directly inoculate precultures into side-streams without sterilization, with salt content providing natural contamination control .

Monitoring Recombinant Protein Production:

  • For fluorescent proteins like YFP: Measure fluorescence intensity as a direct indicator of recombinant protein production and to differentiate D. hansenii from other microorganisms in non-sterile conditions.

  • Bioreactor cultivation: Monitor growth alongside glucose consumption, CO₂ production, and recombinant protein levels throughout the cultivation period .

What chemical-genetic approaches can be used to investigate the TIM22 import pathway?

Chemical-genetic approaches represent powerful tools for investigating mitochondrial protein import pathways. A sophisticated methodology involves:

  • Temperature-sensitive mutant screening: Begin with a collection of temperature-sensitive mutants affecting the TIM22 import pathway (e.g., tim10-1 mutant) that exhibit conditional lethality at restrictive temperatures.

  • Chemical library screening: Screen small molecule libraries for compounds that cause synthetic lethality with temperature-sensitive mutants at permissive temperatures (e.g., 25°C).

  • Verification of pathway specificity: Validate that identified molecules specifically affect the TIM22 pathway by testing import of multiple substrate proteins, including:

    • Carrier proteins (TIM22 pathway substrates)

    • Matrix-targeted preproteins (TIM23 pathway substrates)

    • Intermembrane space proteins (Mia40/Erv1 pathway substrates)

  • Mechanism determination: Use the identified molecules as probes to study specific mechanistic aspects of protein translocation. For example, MitoBloCK-1 impedes binding of the Tim9-Tim10 complex to substrates during early translocation, allowing researchers to study this specific step of the import process .

  • Cross-species validation: Test compounds in both yeast and mammalian systems to determine conservation of import mechanisms and potential relevance to human disease .

What biochemical methods can be used to characterize the interactions between TIM22 and its substrate proteins?

Several sophisticated biochemical methods can be employed to characterize the interactions between TIM22 and its substrate proteins:

  • In vitro import assays:

    • Isolate mitochondria from wild-type and mutant strains

    • Synthesize radiolabeled substrate proteins in vitro

    • Incubate substrates with isolated mitochondria in the presence/absence of chemical inhibitors

    • Analyze import efficiency through autoradiography and quantification

  • Co-immunoprecipitation experiments:

    • Generate tagged versions of TIM22 complex components

    • Solubilize mitochondrial membranes under mild conditions

    • Perform immunoprecipitation with antibodies against the tags

    • Analyze co-precipitating proteins by Western blotting or mass spectrometry

  • Chemical crosslinking:

    • Arrest translocation intermediates using chemical inhibitors

    • Apply membrane-permeable crosslinking agents

    • Identify crosslinked adducts by immunoprecipitation followed by mass spectrometry

    • Map interaction sites between TIM22 and substrates

  • Blue native electrophoresis:

    • Solubilize mitochondrial membranes with mild detergents

    • Separate native protein complexes by gel electrophoresis

    • Identify TIM22 complex components and assembled complexes

    • Compare complex formation in wild-type and mutant strains

How can the salt tolerance of D. hansenii be leveraged for recombinant TIM22 production?

The exceptional salt tolerance of D. hansenii offers unique advantages for recombinant protein production, including TIM22:

  • Non-sterile cultivation strategy:

    • Utilize industrial side-streams with high salt content (e.g., dairy by-products) as growth media

    • The natural salt content (typically >2%) inhibits most contaminating microorganisms while enhancing D. hansenii metabolism

    • Direct inoculation without sterilization reduces processing costs and energy requirements

  • Growth optimization in high-salt conditions:

    • Monitor growth in various salt concentrations to determine optimal conditions for TIM22 expression

    • Fine-tune salt concentration to balance between contamination prevention and optimal protein production

    • Implement fed-batch strategies using salt-rich substrates to maintain high productivity

  • Protein folding advantages:

    • The osmoadaptation mechanisms of D. hansenii may contribute to proper folding of complex membrane proteins like TIM22

    • Compatible solutes accumulated under salt stress can stabilize protein structure

    • Evaluate the effect of salt concentration on TIM22 folding efficiency and functional activity

What analytical methods can be used to assess the functionality of recombinant TIM22?

To evaluate the functionality of recombinant TIM22 produced in D. hansenii, researchers can employ several sophisticated analytical approaches:

  • Reconstitution into liposomes:

    • Purify recombinant TIM22 protein

    • Incorporate the protein into liposomes with defined lipid composition

    • Measure channel activity using electrophysiological techniques

    • Assess voltage-dependence and substrate specificity of the reconstituted channels

  • Complementation studies:

    • Transform TIM22-deficient yeast strains with plasmids expressing recombinant D. hansenii TIM22

    • Evaluate rescue of growth phenotypes at various temperatures

    • Compare import efficiency of known substrates in complemented strains

  • Structural analysis:

    • Perform cryogenic electron microscopy of purified TIM22 or TIM22 complex

    • Generate 3D models of the translocase structure

    • Identify critical residues for channel formation and substrate recognition

    • Compare structural features with TIM22 from other organisms

  • Proteoliposome-based import assays:

    • Reconstitute purified TIM22 with other components of the import machinery into proteoliposomes

    • Generate a membrane potential across the liposome membrane

    • Assess the ability to import purified substrate proteins

    • Measure the effects of inhibitors like MitoBloCK-1 on reconstituted systems

What are the critical factors affecting recombinant protein yield in D. hansenii cultivation?

Several critical factors influence recombinant protein yield when working with D. hansenii:

FactorOptimal ConditionsImpact on Protein Production
Temperature28°CHigher temperatures may reduce protein folding efficiency
pH6.0Significant deviation affects growth and protein stability
Salt concentrationMedia-dependent (naturally high in industrial side-streams)Enhances D. hansenii metabolism while preventing contamination
Carbon source2% glucose (can be derived from side-streams)Affects growth rate and induction of certain promoters
Aeration150 rpm in flask cultures; controlled in bioreactorsInfluences growth rate and protein folding
Growth phaseLate exponential to early stationaryMaximum protein accumulation typically observed

For TIM22 production specifically, membrane protein expression presents additional challenges that can be addressed through:

  • Use of appropriate signal sequences for targeting

  • Careful selection of promoter strength to prevent overloading membrane insertion machinery

  • Monitoring cell stress responses that might indicate toxicity from membrane protein accumulation

How can researchers overcome challenges in studying mitochondrial membrane protein complexes?

Studying mitochondrial membrane protein complexes like the TIM22 complex presents several challenges that can be addressed through specialized methodologies:

  • Protein solubilization challenges:

    • Test multiple detergents (digitonin, DDM, Triton X-100) at various concentrations

    • Apply gentle solubilization protocols at low temperatures

    • Use stabilizing agents like glycerol during purification

    • Consider native nanodiscs for maintaining the native membrane environment

  • Low abundance issues:

    • Develop overexpression systems in D. hansenii using strong promoters

    • Create epitope-tagged versions for efficient purification

    • Implement tandem affinity purification strategies

    • Consider heterologous expression systems if native yields are insufficient

  • Functional assessment:

    • Design reporter systems based on growth complementation

    • Develop in vitro assays measuring specific activities

    • Use fluorescently labeled substrates to directly monitor import

    • Apply chemical crosslinking to capture transient interactions

  • Structural analysis:

    • Combine computational modeling with experimental data

    • Use chemical probes to map functional domains

    • Apply site-directed mutagenesis to verify structure-function relationships

    • Consider comparison with better-characterized orthologs from other species

What strategies can be employed to enhance the stability and activity of recombinant TIM22?

Enhancing the stability and activity of recombinant TIM22 requires addressing the inherent challenges of membrane protein production:

  • Expression optimization:

    • Fine-tune expression levels to prevent aggregation due to overexpression

    • Test different promoters with varying strengths and induction profiles

    • Optimize codon usage for efficient translation in D. hansenii

    • Consider fusion tags that enhance solubility without disrupting function

  • Post-translational modifications:

    • Characterize the native modifications present on TIM22 in D. hansenii

    • Ensure cultivation conditions support proper modification patterns

    • Verify that recombinant TIM22 receives appropriate modifications

    • Assess the impact of modifications on protein stability and activity

  • Purification strategies:

    • Develop gentle extraction protocols using carefully selected detergents

    • Incorporate stabilizing agents during all purification steps

    • Minimize exposure to potentially denaturing conditions

    • Consider rapid purification protocols to limit degradation

  • Storage and handling:

    • Determine optimal buffer compositions for long-term stability

    • Evaluate cryopreservation methods for purified TIM22

    • Test stabilizing additives like glycerol, specific lipids, or substrate analogs

    • Develop activity assays to monitor functional preservation during storage

How can the study of D. hansenii TIM22 contribute to understanding human mitochondrial diseases?

Research on D. hansenii TIM22 has significant potential for advancing our understanding of human mitochondrial diseases through several pathways:

  • Evolutionary conservation of import mechanisms:

    • The fundamental components of the mitochondrial import machinery are conserved from yeast to humans

    • D. hansenii TIM22 shares structural and functional features with human homologs

    • Studies using chemical inhibitors like MitoBloCK-1 demonstrate that targeting the TIM22 pathway affects protein import in both yeast and mammalian cells

  • Model system for mitochondrial disorders:

    • Several human diseases are linked to mutations in components of the mitochondrial import machinery

    • D. hansenii represents a genetically tractable model organism for studying these pathways

    • The salt-tolerance of D. hansenii potentially allows for studies under varying osmotic conditions that may mimic certain pathological states

  • Drug discovery platform:

    • Chemical-genetic screening approaches established with D. hansenii can identify compounds affecting mitochondrial protein import

    • These compounds can serve as starting points for developing therapeutics targeting mitochondrial dysfunction

    • The screening system allows for rapid evaluation of compound specificity and mechanism of action

  • Structure-function relationships:

    • Detailed characterization of D. hansenii TIM22 structure and function can provide insights into human TIM22 complex

    • This knowledge may help interpret the impact of disease-associated mutations

    • Comparative studies between species can highlight critical functional domains

What potential applications exist for engineered D. hansenii strains expressing modified TIM22 variants?

Engineered D. hansenii strains expressing modified TIM22 variants offer several innovative research and biotechnological applications:

How does the TIM22 complex in D. hansenii compare with orthologous complexes in other organisms?

Comparative analysis of the TIM22 complex across species reveals important evolutionary insights:

CharacteristicD. hansenii TIM22 ComplexS. cerevisiae TIM22 ComplexMammalian TIM22 Complex
Core componentsTIM22, TIM9, TIM10, TIM54TIM22, TIM9, TIM10, TIM12, TIM18, TIM54TIM22, TIM9, TIM10, TIM29, AGK
Small Tim chaperonesTim9-Tim10 complexTim9-Tim10 and Tim8-Tim13 complexesTim9-Tim10a and Tim8a-Tim13 complexes
Channel propertiesTwin-pore translocaseTwin-pore translocaseTwin-pore translocase
Substrate specificityCarrier proteins, Tim22, TafazzinCarrier proteins, Tim22, Tim23Carrier proteins, Tim22, Tafazzin
RegulationMembrane potential-dependentMembrane potential-dependentMembrane potential-dependent with additional regulation by AGK

This comparative analysis highlights both conserved features and species-specific adaptations that may relate to the different ecological niches occupied by these organisms. The unique characteristics of D. hansenii TIM22, particularly its operation in high-salt environments, may provide insights into the adaptability of mitochondrial import systems under stress conditions .

How does mitochondrial TIM22 function integrate with other cellular processes in D. hansenii?

The TIM22 complex functions within a broader cellular context, with multiple connections to other cellular processes:

  • Coordination with cytosolic protein synthesis:

    • Nascent TIM22 substrates require coordination between cytosolic ribosomes and mitochondrial import machinery

    • Chaperones like Hsp70 and Hsp90 likely facilitate handoff of hydrophobic proteins to the TIM22 pathway

    • Translation kinetics and TIM22 import capacity must be balanced to prevent aggregation of hydrophobic substrates

  • Integration with mitochondrial biogenesis:

    • TIM22 function directly impacts the assembly of the mitochondrial inner membrane proteome

    • Carrier proteins imported via TIM22 are essential for metabolite exchange between mitochondria and cytosol

    • Changes in metabolic state likely modulate TIM22 substrate expression and import requirements

  • Stress response connections:

    • D. hansenii's exceptional stress tolerance, particularly to salt, may involve specialized regulation of mitochondrial function

    • The mitochondrial import machinery likely plays a role in cellular adaptation to osmotic stress

    • TIM22 function may be modified during stress conditions to prioritize import of specific proteins needed for adaptation

  • Cell wall integrity and antifungal resistance:

    • D. hansenii produces enzymes like β-1,3-glucanase, chitinase, and protease that contribute to its antifungal properties

    • Mitochondrial function supports the energy requirements for enzyme production

    • The TIM22 complex indirectly supports these defensive capabilities by maintaining mitochondrial protein composition

What emerging technologies might advance our understanding of TIM22 function in D. hansenii?

Several cutting-edge technologies show promise for deepening our understanding of TIM22 function:

  • CRISPR-Cas9 genome editing:

    • Precise modification of TIM22 and associated genes in D. hansenii

    • Creation of conditional mutants for studying essential functions

    • Introduction of reporter tags at endogenous loci

    • Investigation of regulatory elements controlling TIM22 expression

  • Cryo-electron tomography:

    • Visualization of TIM22 complexes in their native membrane environment

    • Analysis of spatial organization within mitochondrial membranes

    • Observation of translocating substrates in near-native conditions

    • 3D reconstruction of the import machinery architecture

  • Proteomics approaches:

    • Quantitative analysis of the D. hansenii mitochondrial proteome under various conditions

    • Identification of TIM22-dependent changes in protein composition

    • Characterization of post-translational modifications affecting TIM22 function

    • Protein interaction mapping using proximity labeling techniques

  • Single-molecule techniques:

    • Real-time observation of individual substrate translocation events

    • Measurement of force generation during protein import

    • Analysis of conformational changes during the import cycle

    • Determination of kinetic parameters for different substrate classes

  • Synthetic biology approaches:

    • Creation of minimal TIM22 complexes with defined components

    • Engineering of substrate specificity through rational design

    • Development of artificial import pathways with novel functions

    • Integration of TIM22 function into designer organelles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.