Recombinant Debaryomyces hansenii Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TIM50; DEHA2B15642g; Mitochondrial import inner membrane translocase subunit TIM50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
105-471
Protein Length
Full Length of Mature Protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
TIM50
Target Protein Sequence
RERYANMFYLATLVGGIAGVGYMCRDWDSEDEQTKLEGKDIDNGFAPNLMYGRLNKRLGS LFTFFSEPVFENLLPPPAPEAYRRPLTLVVTLDDLLIHSDWDTKHGWRTGKRPGLDYFLG YLSQYYEIVIFGSNYQMYSENTVGKLDPFHAYVSYALFREACRYKDGKLVKDLSLLNRDL GKTVLIDVEEDSWSMQPDNAIPMKPWDGSYDDTLVKLIPFLEYLATQPVKDVRPILNSFK DKSNIVQEFAEREAKLREQWKKDNKHLFDSANRPNAGNFLASLMGVPTSSVNKEPKMPLD IIREHGQLQYEHFQKYLKENAPKFLEEEQKLKDEFGKVSLNKLITEGAPSADDIAKVQAE RAAAQQQ
Uniprot No.

Target Background

Function
TIM50 is an essential component of the TIM23 complex, which mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Its function involves directing preproteins during transit to the TIM23 channel protein. It likely also facilitates the transfer of translocating proteins from the TOM complex to the TIM23 complex.
Database Links
Protein Families
TIM50 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.