Recombinant Debaryomyces hansenii Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TIM54; DEHA2C17226g; Mitochondrial import inner membrane translocase subunit TIM54
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-495
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
TIM54
Target Protein Sequence
MSENPEPSKGSTPNVEGAEKVNKPPVKKGWSNPALRMMGIPKISLPSRNWMIFWTLLASV GGGVAYDRYQQKQIRKKWMEKFEPLGEEAYRTDRIPRKLSVFIAPPPNDYLDSSMVYFRK YVKPLLNASAIDFDVFTENRQGDIRAAVAERIRELRIETNENAKKAQEEAKQEQYDASWT KFFKKDVPNFFTLKFQSNSKEDEALVSSNDLYSPKDVLGLYYLKEPIDAKRDDELNPMEA GGVICIGRGAYKEYMTGVHEGLLGPLEAPEEVRTITEVDPQVTENEPETAHNDNESKAVV ELPVLPTDDLPADSVDKQDAVPETPSETAENTPNAEEGDNEKPVPKPFITPDEYPNATYA PEFQNVSLIMNKKNVPVIFEQPVYVFPLPIVSGFLNTHRKLYRFFTKRNVADDYGCRTSV VVQNVSRPFVYKDQFMAKEEELEWPKKWVATGKEKNSEWVQELVTDDRVTTRMKVFDVSL AAKSTDKPIDKPTNE
Uniprot No.

Target Background

Function

Recombinant Debaryomyces hansenii Mitochondrial Import Inner Membrane Translocase Subunit TIM54 (TIM54): An essential component of the TIM22 complex, this protein facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex functions as a twin-pore translocase, utilizing the membrane potential as its driving force.

Database Links
Protein Families
TIM54 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Debaryomyces hansenii TIM54 and what is its significance in mitochondrial biology?

TIM54 (Mitochondrial import inner membrane translocase subunit TIM54) is an essential integral membrane protein localized to the mitochondrial inner membrane in Debaryomyces hansenii. It forms part of a specialized protein complex involved in the insertion of polytopic proteins into the mitochondrial inner membrane . The significance of TIM54 lies in its role within a dedicated protein insertion pathway distinct from the matrix protein import pathway. In yeast mitochondria, TIM54 functions within the TIM22 complex (also called the carrier translocase), which is specialized for the insertion of multi-spanning membrane proteins with internal targeting signals, as opposed to the TIM23 complex which handles presequence-containing proteins destined for the matrix .

How does TIM54 function within the mitochondrial protein import machinery?

TIM54 functions as part of a specialized protein complex in the inner mitochondrial membrane that is distinct from the Tim23p-Tim17p complex. Based on studies in yeast systems, TIM54 partners primarily with TIM22 to form a complex specifically required for inserting polytopic proteins into the inner membrane .

This selective function is evidenced by experimental data showing that tim54 mutations in yeast significantly impair the insertion of inner membrane proteins (such as the ATP/ADP carrier protein and Tim23p) while having minimal effect on matrix protein import. The functional organization of mitochondrial import can be summarized as follows:

ComplexMain ComponentsPrimary FunctionSubstrate Examples
TIM22 ComplexTim54p, Tim22pInner membrane protein insertionATP/ADP carrier (Aac1p), Tim23p
TIM23 ComplexTim23p, Tim17pMatrix protein translocationSu9-DHFR, Cox4p

Experimental evidence from yeast shows that in tim54-1 mutants, the import of inner membrane-destined Aac1 protein was reduced at least fivefold compared to wild-type mitochondria, while matrix-targeted Su9-DHFR import remained efficient .

What expression systems are optimal for recombinant D. hansenii TIM54 production?

For recombinant TIM54 from D. hansenii, E. coli expression systems have been successfully employed, as evidenced by commercially available recombinant proteins . The optimal approach typically involves:

  • Vector selection: Vectors containing strong, inducible promoters (e.g., T7) with appropriate fusion tags (commonly His-tag for purification)

  • E. coli strain optimization: BL21(DE3) or Rosetta strains are frequently used for membrane protein expression

  • Expression conditions: Reduced temperature (16-20°C) after induction to slow protein production and improve folding

  • Induction optimization: Lower IPTG concentrations (0.1-0.5 mM) to prevent formation of inclusion bodies

When working with D. hansenii directly, recent advances in genetic tools are particularly valuable. The development of efficient PCR-based gene targeting methods now allows for gene disruption or expression at high efficiency (>75% of transformants show correct integration) using just 50 bp homology flanks .

What are the recommended purification strategies for recombinant TIM54?

Purification of recombinant TIM54 requires specialized approaches due to its membrane protein nature:

  • Membrane extraction: Detergent solubilization is critical, with typical detergents including:

    • n-Dodecyl β-D-maltoside (DDM)

    • Digitonin (for milder extraction)

    • CHAPS (for retaining protein-protein interactions)

  • Affinity chromatography: Utilizing the His-tag for IMAC (Immobilized Metal Affinity Chromatography)

    • Initial capture on Ni-NTA resin

    • Washing with low imidazole (10-30 mM) to reduce non-specific binding

    • Elution with higher imidazole concentration (250-300 mM)

  • Secondary purification: Size exclusion chromatography to separate monomeric protein from aggregates

  • Quality assessment: Purity greater than 90% can be achieved as determined by SDS-PAGE

  • Storage considerations:

    • Recommended storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Addition of 5-50% glycerol (final concentration) for long-term storage

    • Aliquoting to avoid repeated freeze-thaw cycles

    • Storage at -20°C/-80°C

How can researchers verify the functional activity of purified TIM54?

Functional verification of TIM54 requires assays that assess its native activity in mitochondrial protein insertion:

  • Reconstitution assays:

    • Incorporation of purified TIM54 into liposomes

    • Assessment of membrane insertion activity using labeled substrate proteins

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with known partners (particularly TIM22)

    • In yeast systems, TIM54 and TIM22 can be co-precipitated from detergent-solubilized mitochondria

  • In vitro import assays:

    • Using isolated mitochondria from wild-type and tim54-mutant strains

    • Measuring import of radiolabeled precursor proteins

    • Comparing matrix protein import vs. inner membrane protein insertion

    • Analysis by protease protection assays to verify complete insertion

  • Complementation studies:

    • Expression of D. hansenii TIM54 in tim54-deficient yeast

    • Assessment of growth rescue and protein import function

How does D. hansenii TIM54 functionally compare to its homologs in other yeasts?

D. hansenii TIM54 shares structural and functional similarities with homologs in other yeasts, but with several notable distinctions reflecting D. hansenii's unique physiological adaptations:

  • Functional conservation: The core function in inner membrane protein insertion appears conserved across yeast species. Like S. cerevisiae TIM54, the D. hansenii protein likely forms a complex with TIM22 to facilitate insertion of polytopic proteins into the inner membrane .

  • Sequence comparison:

    • D. hansenii TIM54 shows moderate sequence homology to S. cerevisiae TIM54

    • Key functional domains are likely conserved, particularly those involved in TIM22 interaction

    • Species-specific variations may relate to D. hansenii's halotolerance

  • Halotolerance adaptation: D. hansenii is known for its remarkable tolerance to high salt concentrations, which may be reflected in adaptations of its mitochondrial import machinery . TIM54 could potentially contribute to this stress resistance through:

    • Enhanced protein stability under high ionic conditions

    • Modified interactions with partner proteins

    • Altered regulation under osmotic stress

  • Experimental methods for comparative analysis:

    • Heterologous expression and complementation in S. cerevisiae tim54 mutants

    • Biochemical comparison of protein stability under varying salt conditions

    • Structural studies to identify salt-adaptive modifications

What experimental approaches can reveal TIM54's protein interaction network?

Elucidating TIM54's interaction network requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Generation of antibodies against D. hansenii TIM54 or use of epitope-tagged versions

    • Solubilization of mitochondrial membranes using mild detergents (digitonin preferred)

    • Identification of co-precipitated proteins by mass spectrometry

    • Precedent from yeast studies shows successful co-precipitation of Tim22p with Tim54p

  • Proximity-based labeling:

    • Fusion of TIM54 with enzymes like BioID or APEX2

    • In vivo labeling of proximal proteins

    • Mass spectrometry identification of labeled proteins

  • Crosslinking mass spectrometry:

    • Chemical crosslinking of intact mitochondria

    • Digestion and MS analysis to identify crosslinked peptides

    • Structural mapping of interaction sites

  • Genetic interaction screens:

    • Synthetic genetic array (SGA) analysis in model yeasts

    • CRISPR-based screens in D. hansenii using the recently developed gene targeting methods

  • Two-hybrid screening:

    • Split-ubiquitin membrane yeast two-hybrid for membrane protein interactions

    • Screening against mitochondrial protein libraries

The interaction data can be visualized and analyzed as a network to identify key functional partners and potential regulatory connections.

How can genetic manipulation of TIM54 in D. hansenii be achieved?

Recent advances have significantly improved genetic manipulation capabilities in D. hansenii:

  • PCR-based gene targeting:

    • High-efficiency method (>75% correct integration) using just 50 bp homology flanks

    • PCR amplification of a heterologous selectable marker with 50 bp flanks identical to the target site

    • Direct transformation into wild-type isolates without requiring auxotrophic markers

  • CRISPR-Cas9 approaches:

    • Recently developed CRISPR-Cas9 toolbox for D. hansenii

    • Enables precise genome editing

    • Can be used for gene disruption, point mutations, or insertions

  • TIM54 specific strategies:

    • Gene deletion: Replace entire ORF with selectable marker

    • Domain analysis: Create truncation or internal deletion variants

    • Point mutations: Target conserved residues identified through sequence analysis

    • Epitope tagging: C-terminal tagging less likely to disrupt function

  • Expression optimization:

    • Promoter selection is critical - TEF1 promoter from Arxula adeninivorans has shown high expression levels in D. hansenii

    • Codon optimization may improve expression

    • In vivo DNA assembly in D. hansenii allows screening of different promoters, terminators, and signal peptides in a single step

What are common challenges in expressing and purifying D. hansenii TIM54?

Researchers working with TIM54 face several common challenges:

  • Expression yield issues:

    • Membrane proteins like TIM54 often express at lower levels

    • Solution: Optimize by testing multiple expression strains, varying induction conditions, and using specialized expression vectors

  • Protein misfolding and aggregation:

    • Common with membrane proteins when overexpressed

    • Solution: Lower expression temperature (16-20°C), reduce inducer concentration, include molecular chaperones

  • Poor solubilization:

    • Inefficient extraction from membranes

    • Solution: Screen multiple detergents (DDM, LDAO, digitonin) at various concentrations; consider detergent mixtures

  • Loss of function during purification:

    • Denaturation during extraction and purification steps

    • Solution: Use milder detergents, maintain protein in cold conditions, add stabilizing agents like glycerol

  • Detergent interference with downstream applications:

    • Detergents can affect functional assays and structural studies

    • Solution: Detergent exchange, use of amphipols or nanodiscs for reconstitution

How can researchers minimize degradation of recombinant TIM54 during preparation and storage?

Preventing degradation of TIM54 requires careful attention to several factors:

  • During expression:

    • Include protease inhibitors in all buffers

    • Express in protease-deficient strains (e.g., BL21)

    • Harvest cells promptly after reaching optimal expression levels

  • During purification:

    • Maintain cold temperature throughout purification

    • Include protease inhibitor cocktails in all buffers

    • Minimize purification time to reduce exposure to proteases

    • Consider adding reducing agents to prevent oxidation

  • Storage conditions:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Add 5-50% glycerol as cryoprotectant

    • Aliquot to avoid repeated freeze-thaw cycles

    • Flash-freeze in liquid nitrogen before -80°C storage

    • For working stocks, store at 4°C for up to one week

  • Stability assessment:

    • Monitor protein integrity by SDS-PAGE before experiments

    • Consider thermal shift assays to identify stabilizing buffer conditions

    • Test various additives (e.g., trehalose, sucrose, specific lipids) for improved stability

What controls should be included in functional assays for TIM54?

Robust experimental design for TIM54 functional studies requires appropriate controls:

  • Positive controls:

    • Wild-type TIM54 protein (when testing mutant variants)

    • Known substrate proteins with established import parameters

    • Intact mitochondria with confirmed import competence

  • Negative controls:

    • Heat-denatured TIM54 to confirm specificity

    • Non-mitochondrial membrane proteins to control for non-specific effects

    • Assays performed in the absence of membrane potential (using uncouplers like valinomycin)

    • Proteins known to use alternative import pathways (e.g., matrix-targeted proteins)

  • Specificity controls:

    • Competition assays with unlabeled substrates

    • Antibody inhibition of specific import components

    • Use of tim54-1 mutant mitochondria to demonstrate TIM54-dependent effects

  • System validation:

    • Parallel import assays for matrix proteins (e.g., Su9-DHFR) and inner membrane proteins (e.g., Aac1p)

    • Protease protection assays to verify complete insertion vs. surface association

    • Fractionation controls to confirm proper submitochondrial localization

How is TIM54 involved in D. hansenii's remarkable halotolerance?

D. hansenii is known for its exceptional tolerance to high salt concentrations, and mitochondrial function may play an important role in this adaptation:

  • Potential mechanisms linking TIM54 to halotolerance:

    • Specialized import of salt-responsive mitochondrial proteins

    • Maintenance of mitochondrial protein homeostasis under osmotic stress

    • Contribution to mitochondrial membrane integrity in high salt environments

  • Research approaches:

    • Comparative analysis of TIM54 expression and activity under varying salt conditions

    • Identification of salt-specific protein substrates whose import depends on TIM54

    • Assessment of mitochondrial function in tim54 mutants under salt stress

    • Evaluation of whether D. hansenii's natural habitat in salt-rich environments has selected for adaptations in its mitochondrial import machinery

  • Preliminary observations:

    • D. hansenii thrives in by-products rich in salt from the dairy and pharmaceutical industries

    • High salt concentration favors D. hansenii's metabolism while hindering non-halotolerant microorganisms

    • This suggests specialized mitochondrial adaptations, potentially involving TIM54-mediated protein import

Can genetic manipulation of TIM54 enhance protein production in D. hansenii?

D. hansenii has significant biotechnological potential, particularly for protein production in high-salt environments:

  • TIM54's potential impact on recombinant protein production:

    • Optimization of mitochondrial function could enhance cellular energy production

    • Modified protein import machinery might improve cell factory performance

    • Enhanced stress tolerance through TIM54 manipulation could improve production yields

  • Experimental approaches:

    • Generation of TIM54 variants with enhanced activity or stability

    • Co-expression of TIM54 with other components of the TIM22 complex

    • Integration of heterologous proteins into "safe harbor" chromosomal sites using new genetic tools

    • Screening TIM54 variants for improved performance in industrial by-product media

  • Applications in bioprocessing:

    • Utilization of salt-rich industrial by-products as growth media

    • Development of non-sterile cultivation processes leveraging D. hansenii's salt tolerance

    • Production of recombinant proteins without requiring nutritional supplements or freshwater

What is the role of TIM54 in D. hansenii's stress response mechanisms?

Beyond salt tolerance, D. hansenii exhibits remarkable resistance to multiple stressors, with TIM54 potentially playing a central role:

  • Stress conditions where TIM54 may be important:

    • Oxidative stress resistance

    • Tolerance to fermentation inhibitors (furfural, vanillin, organic acids)

    • Adaptation to varying pH conditions

    • Response to temperature fluctuations

  • Potential mechanisms:

    • Import of stress-responsive proteins into mitochondria

    • Maintenance of mitochondrial function under stress conditions

    • Adaptation of import selectivity during stress response

  • Research directions:

    • Transcriptomic and proteomic profiling of tim54 mutants under various stresses

    • Comparative analysis of the TIM54 interactome under normal vs. stress conditions

    • Investigation of post-translational modifications of TIM54 during stress response

    • Assessment of whether TIM54's role in protein import contributes to D. hansenii's potential as a cell factory for the green transition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.