Recombinant Debaryomyces hansenii Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Debaryomyces hansenii Mitochondrial Inner Membrane i-AAA Protease Complex Subunit MGR1 (MGR1)

Recombinant Debaryomyces hansenii Mitochondrial Inner Membrane i-AAA Protease Complex Subunit MGR1 (MGR1) is a full-length, His-tagged protein expressed in E. coli for biochemical and functional studies. This 342-amino-acid protein (UniProt ID: Q6BNL9) plays a critical role in mitochondrial inner membrane protein turnover as part of the i-AAA protease supercomplex, which is essential for mitochondrial genome stability and substrate degradation .

Amino Acid Sequence

The full sequence (MGVYIPPGSGGNDNGKSGGSGDNTLTIPNPASFIPQNPSLGLRLWGPLVPASDNLPALYF...VDESHI) includes conserved domains critical for substrate recognition and protease activity .

Functional Significance in Mitochondrial Proteostasis

MGR1 functions as an adaptor subunit of the Yme1-Mgr1-Mgr3 i-AAA protease complex, which:

  • Substrate Recruitment: Binds to mitochondrial outer membrane (MOM) proteins via its intermembrane space (IMS) domain, facilitating their degradation .

  • Quality Control: Degrades misfolded proteins and regulates mitochondrial genome stability .

  • Genetic Dependency: Essential for growth in cells lacking mitochondrial DNA (ρ⁰ strains) .

Studies in Saccharomyces cerevisiae homologs reveal that MGR1 deletion destabilizes the protease complex, impairing substrate processing and leading to mitochondrial dysfunction .

Expression Systems

  • Host: Recombinant MGR1 is expressed in E. coli due to its scalability and cost-effectiveness .

  • Yield: Optimized protocols achieve >90% purity via affinity chromatography (His tag) .

Biotechnological Relevance

  • High-Salt Cultivations: D. hansenii’s halotolerance enables recombinant protein production in saline industrial by-products (e.g., dairy waste), reducing freshwater dependency .

  • Non-Sterile Fermentation: Open cultivations in 1 M NaCl inhibit competing microbes, enhancing MGR1 yield .

Functional Studies

  • Substrate Specificity: MGR1 binds MOM proteins (e.g., Tom22) via IMS domains, requiring ATPase activity for proteolysis .

  • Adaptor Role: Mgr1-Mgr3 subcomplexes stabilize Yme1 and enhance substrate recruitment efficiency .

Comparative Analysis Across Species

SpeciesMGR1 Homolog FeaturesReference
Saccharomyces cerevisiaeShares 45% sequence identity; critical for ρ⁰ growth
Candida glabrataPartial homology; uncharacterized function
Ashbya gossypiiMitochondrial protease adapter; 38 kDa

Challenges and Future Directions

  • Structural Resolution: No crystal structure exists for D. hansenii MGR1, limiting mechanistic insights .

  • Industrial Scaling: Optimizing salt-rich fermentations for high-yield MGR1 production remains a priority .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
MGR1; DEHA2E20680g; Mitochondrial inner membrane i-AAA protease complex subunit MGR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
MGR1
Target Protein Sequence
MGVYIPPGSGGNDNGKSGGSGDNTLTIPNPASFIPQNPSLGLRLWGPLVPASDNLPALYF LTSLQIGIGLLSFNKVRYLRRSNLARFGIENTWQRRSTKWLCAIGGSYLVYQSGIEMSRL AMPYDPWYDEAKFYRKLAIKNGDNPSWWFGATGYYKPMNYKEWYTKIDKWFNNQINIIDA EHENVDTASSQVSTRGKHPQSPLLSSLSRKGKYSEIYQSLHESNIKRYKKLLDQSLKDVN ELNKAERLDLIMEGKSSIKYNEEYLKPHIQLGNHRIDTDEEFEMVWLNFEPWDELKMETD YDIRLVPRWRWSEDEDVEASSTESVPTEPTTNLVNEVDESHI
Uniprot No.

Target Background

Function
Component of the mitochondrial inner membrane i-AAA protease complex required for mitochondrial inner membrane protein turnover.
Database Links
Protein Families
MGR1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does MGR1 contribute to protein quality control in D. hansenii mitochondria?

MGR1 contributes to mitochondrial protein quality control through its role in the i-AAA protease complex. Based on studies in related yeasts, MGR1 recognizes specific substrate proteins in the mitochondrial outer membrane through its IMS domain and facilitates their recruitment to the Yme1 protease . This process is critical for the degradation of damaged or misfolded proteins, helping maintain mitochondrial proteostasis.

To investigate this function, researchers should:

  • Generate MGR1 deletion strains and assess accumulation of potential substrate proteins

  • Perform co-immunoprecipitation experiments to identify interacting proteins

  • Conduct in vivo degradation assays using known substrate proteins tagged with epitopes

  • Compare mitochondrial function and morphology between wild-type and MGR1-deficient cells

What methods are recommended for purifying recombinant D. hansenii MGR1?

For successful purification of recombinant D. hansenii MGR1, follow this methodological approach:

  • Expression system: Use E. coli BL21(DE3) with pET vectors containing a 6xHis-tag or GST-tag

  • Growth conditions: Induce with 0.5 mM IPTG at 18°C overnight to minimize inclusion body formation

  • Cell lysis: Use buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% Triton X-100, and protease inhibitors

  • Purification steps:

    • Initial capture: Ni-NTA or glutathione affinity chromatography

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Storage: Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Quality control: Assess purity by SDS-PAGE and functionality through substrate binding assays

Monitor protein stability throughout purification as membrane proteins can aggregate during extraction from their native environment.

How does the Yme1-Mgr1-Mgr3 complex recognize and process mitochondrial outer membrane proteins?

The recognition and processing of mitochondrial outer membrane proteins by the Yme1-Mgr1-Mgr3 complex involves several sophisticated steps. Research in S. cerevisiae has revealed that Mgr1 and Mgr3 specifically recognize the intermembrane space (IMS) domains of mitochondrial outer membrane substrates and facilitate their recruitment to Yme1 for proteolysis . This process requires both the adapter function of Mgr1/Mgr3 and the ATPase activity of Yme1.

To investigate this mechanism in D. hansenii, researchers should:

  • Perform immunoprecipitation and in vivo site-specific photo-crosslinking experiments to capture substrate-MGR1 interactions

  • Generate catalytically inactive Yme1 mutants (K327R, E381Q, E541Q) to trap substrate intermediates

  • Use fluorescence resonance energy transfer (FRET) to monitor protein-protein interactions in real-time

  • Develop an in vitro reconstituted system with purified components to dissect individual steps of substrate processing

The following data table illustrates the effect of Yme1 mutations on substrate processing:

Yme1 VariantATPase Activity (%)Substrate Translocation (%)Degradation Efficiency (%)
Wild-type100100100
K327R (Walker A)<5<10<10
E381Q (Walker B)<5<10<10
E541Q (Protease)100100<10

These results indicate that both the ATPase and protease functions are essential for complete substrate processing .

How might MGR1 function contribute to D. hansenii's exceptional stress tolerance?

Debaryomyces hansenii is known for its remarkable ability to grow under extreme conditions, including high salt concentrations and alkaline pH . The mitochondrial quality control system likely plays a crucial role in this adaptation. To investigate MGR1's contribution to stress tolerance:

  • Create MGR1 deletion mutants and test growth under various stress conditions:

    • High salinity (5-24% NaCl)

    • Alkaline pH (pH 8-10)

    • Oxidative stress (H₂O₂ exposure)

    • Temperature extremes

  • Analyze mitochondrial function in wild-type vs. Δmgr1 strains under stress:

    • Oxygen consumption rates

    • Membrane potential measurements

    • ROS production quantification

    • ATP synthesis capacity

  • Perform global proteomics analysis to identify:

    • Proteins that accumulate in Δmgr1 strains under stress (potential substrates)

    • Compensatory changes in protein expression

    • Altered post-translational modifications

  • Investigate metabolic adaptations through metabolomics:

    • Quantify osmoprotectant production

    • Measure changes in key metabolic pathways

    • Analyze lipid composition alterations

These approaches will help elucidate whether MGR1's role in protein quality control contributes to D. hansenii's exceptional stress tolerance capabilities.

What is the mechanism of ATPase-dependent substrate translocation in the i-AAA protease complex?

The i-AAA protease complex can translocate substrate cytoplasmic domains into the intermembrane space through the ATPase activity of Yme1 . This process is essential for the complete degradation of membrane proteins with domains on both sides of the membrane.

To investigate this mechanism:

  • Design model substrates with domains of varying sizes and stability

  • Perform in vitro reconstitution experiments with purified components

  • Use site-specific crosslinking to capture translocation intermediates

  • Measure ATP hydrolysis rates during substrate processing

Research has demonstrated that mutations in the Walker A (K327R) and Walker B (E381Q) motifs of Yme1 abolish both ATPase activity and substrate translocation, while protease domain mutations (E541Q) affect only the final degradation step . This suggests a sequential process where:

  • Mgr1/Mgr3 recognize and bind substrate IMS domains

  • Substrates are presented to Yme1

  • Yme1 uses ATP hydrolysis to translocate substrate domains

  • The protease domain cleaves the translocated protein

This model explains how the complex can access and degrade membrane proteins with topologically separated domains.

How do post-translational modifications regulate MGR1 function?

Post-translational modifications (PTMs) likely play critical roles in regulating MGR1 function, though specific PTMs in D. hansenii MGR1 have not been extensively characterized. To investigate this aspect:

  • Identify potential modification sites:

    • Perform in silico analysis of the MGR1 sequence for phosphorylation, acetylation, and ubiquitination sites

    • Compare predicted sites with those conserved in orthologs from other yeasts

  • Detect and map actual modifications:

    • Use mass spectrometry-based proteomics to identify PTMs on purified MGR1

    • Compare modification patterns under different growth conditions

  • Investigate functional consequences:

    • Generate non-modifiable mutants (e.g., S/T to A for phosphorylation sites)

    • Create phosphomimetic mutants (S/T to D/E)

    • Test these mutants for substrate binding, Yme1 interaction, and in vivo function

  • Identify regulatory enzymes:

    • Screen kinase/phosphatase libraries for enzymes that modify MGR1

    • Perform co-immunoprecipitation to identify associated modifying enzymes

Understanding PTM regulation of MGR1 will provide insights into how mitochondrial quality control responds dynamically to changing cellular conditions.

What controls are essential when studying MGR1 function in protein degradation assays?

When designing protein degradation assays to study MGR1 function, the following controls are essential:

  • Genetic controls:

    • Wild-type strain (positive control)

    • MGR1 deletion (Δmgr1)

    • MGR1 complemented strain (Δmgr1 + MGR1)

    • YME1 deletion (Δyme1) to distinguish Yme1-dependent effects

    • MGR3 deletion (Δmgr3) to assess adapter partner function

  • Substrate controls:

    • Known Yme1 substrates (e.g., Nde1-HA)

    • Non-Yme1 substrates (e.g., Fzo1-HA) as negative controls

    • Substrates with mutations in recognition elements

  • Assay controls:

    • Translation inhibition controls (cycloheximide)

    • Proteasome inhibitors to rule out cytosolic degradation

    • ATP depletion to confirm energy dependence

  • Time course considerations:

    • Multiple time points to calculate degradation kinetics

    • Consistent harvesting and processing procedures

    • Internal loading controls for quantification

For cycloheximide chase experiments, collect samples at 0, 15, 30, 60, and 120 minutes after translation inhibition, and analyze by immunoblotting with appropriate antibodies. Quantify band intensities using image analysis software and fit to exponential decay curves to determine half-lives.

How should researchers design experiments to identify the substrate specificity of D. hansenii MGR1?

To comprehensively identify MGR1 substrate specificity in D. hansenii, implement the following experimental design:

  • Comparative proteomics approach:

    • Compare protein levels in wild-type vs. Δmgr1 strains using SILAC or TMT labeling

    • Focus on mitochondrial membrane proteins that accumulate in Δmgr1

    • Validate candidates through targeted degradation assays

  • Physical interaction screening:

    • Perform co-immunoprecipitation with tagged MGR1 as bait

    • Use crosslinking approaches to capture transient interactions

    • Validate interactions through reverse co-immunoprecipitation

  • In vitro binding assays:

    • Express and purify recombinant MGR1 IMS domain

    • Create a library of potential substrate IMS domains

    • Perform systematic binding assays using techniques like:

      • Surface plasmon resonance

      • Microscale thermophoresis

      • Fluorescence polarization

  • Structure-based analysis:

    • Identify common structural features in confirmed substrates

    • Use machine learning to predict additional candidates

    • Test predictions through directed experiments

  • In vivo validation:

    • Generate reporter constructs for candidate substrates

    • Monitor their stability in wild-type vs. mutant backgrounds

    • Perform mutagenesis of potential recognition elements

This multi-faceted approach will help build a comprehensive understanding of MGR1 substrate recognition principles.

What approaches can be used to study the D. hansenii MGR1 interactome?

Understanding the complete interactome of D. hansenii MGR1 requires multiple complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express epitope-tagged MGR1 in D. hansenii

    • Perform gentle solubilization using appropriate detergents

    • Identify co-purifying proteins by LC-MS/MS

    • Filter against control purifications to remove non-specific interactions

  • Proximity labeling approaches:

    • Generate MGR1 fusions with BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • This captures both stable and transient interactions

  • Yeast two-hybrid screening:

    • Use MGR1 domains as baits against D. hansenii cDNA library

    • Focus on IMS domain for substrate interactions

    • Validate hits with orthogonal methods

  • Split reporter systems:

    • DHFR, luciferase, or GFP complementation assays

    • Test specific interaction pairs in vivo

    • Monitor dynamics of interactions under different conditions

  • Crosslinking mass spectrometry:

    • Use chemical crosslinkers to capture protein-protein interactions

    • Identify crosslinked peptides by MS/MS

    • Map interaction interfaces at amino acid resolution

Data from these approaches should be integrated to build a comprehensive interaction network, with interactions classified as components of the i-AAA complex, substrates, or regulatory partners.

How should researchers analyze protein degradation kinetics for MGR1-dependent substrates?

Analyzing protein degradation kinetics for MGR1-dependent substrates requires rigorous quantitative approaches:

  • Model fitting for degradation curves:

    • Use non-linear regression to fit first-order exponential decay: P(t) = P₀e^(-kt)

    • Calculate protein half-life (t₁/₂ = ln(2)/k)

    • Compare degradation rate constants (k) between conditions

    • For biphasic degradation, consider two-phase exponential models

  • Statistical analysis:

    • Perform experiments with at least three biological replicates

    • Calculate means, standard deviations, and confidence intervals

    • Use appropriate statistical tests:

      • t-tests for comparing two conditions

      • ANOVA with post-hoc tests for multiple conditions

      • Non-parametric tests for non-normally distributed data

  • Data visualization:

    • Plot degradation curves on semi-log scale to visualize first-order kinetics

    • Include error bars representing standard deviation or standard error

    • Present representative immunoblots alongside quantification

Example data table for analyzing substrate degradation:

Time (min)WT (% remaining)Δmgr1 (% remaining)Δyme1 (% remaining)
0100.0 ± 4.2100.0 ± 3.8100.0 ± 5.1
3068.5 ± 5.392.7 ± 4.697.3 ± 4.8
6042.1 ± 3.988.5 ± 5.295.8 ± 6.2
12017.6 ± 2.885.2 ± 4.993.4 ± 5.5
t₁/₂ (min)52.8 ± 4.1>240>240

These analyses allow researchers to quantitatively assess MGR1's contribution to substrate degradation and compare effects across different genetic backgrounds.

How can researchers distinguish between direct and indirect effects of MGR1 deletion?

Distinguishing between direct and indirect effects of MGR1 deletion is crucial for accurate interpretation of experimental results. Implement these methodological approaches:

  • Temporal studies:

    • Use inducible systems for acute MGR1 depletion

    • Monitor changes at multiple time points after depletion

    • Early effects (minutes to hours) are more likely direct

    • Late effects (many hours to days) may be indirect

  • Biochemical validation:

    • Demonstrate direct physical interaction between MGR1 and putative substrates

    • Use in vitro systems with purified components to reconstitute activities

    • Compare binding affinities across different substrates

  • Structure-function analysis:

    • Generate MGR1 point mutants that specifically affect certain interactions

    • Create chimeric proteins to map functional domains

    • Use these tools to separate different functions of MGR1

  • Complementation strategies:

    • Test whether wild-type MGR1 expression rescues phenotypes

    • Determine whether specific MGR1 domains are sufficient for rescue

    • Use heterologous adapters from related organisms as functional probes

  • Systems-level analysis:

    • Integrate data from proteomics, transcriptomics, and metabolomics

    • Use network analysis to identify primary vs. secondary nodes

    • Apply mathematical modeling to distinguish direct regulatory effects

These approaches collectively help separate direct consequences of MGR1 function from downstream adaptive responses or secondary effects of compromised mitochondrial quality control.

What approaches can resolve contradictory findings between in vitro and in vivo studies of MGR1?

Contradictions between in vitro and in vivo studies of MGR1 require systematic resolution strategies:

  • Identify specific discrepancies:

    • Create a comprehensive table comparing findings from each system

    • Categorize discrepancies by type (kinetic, interaction partners, localization)

    • Prioritize investigation of critical contradictions

  • Examine methodological differences:

    • Compare protein concentrations between systems

    • Assess detergent effects on protein conformation and function

    • Evaluate buffer components that might affect activity

    • Consider the absence of specific cofactors or binding partners in vitro

  • Develop intermediate complexity systems:

    • Isolated mitochondria (in organello) experiments

    • Reconstituted proteoliposomes with defined composition

    • Semi-permeabilized cell systems

  • Targeted validation experiments:

    • Design experiments specifically addressing contradictions

    • Use orthogonal techniques to verify key findings

    • Employ genetic approaches to test mechanistic hypotheses

  • Integrated interpretation:

    • Consider that in vitro systems reveal biochemical capacity

    • In vivo systems show physiological regulation and constraints

    • Develop models that incorporate both perspectives

    • Acknowledge limitations of each experimental approach

This systematic approach helps develop a unified understanding that accounts for seemingly contradictory results and provides a more complete picture of MGR1 function.

What strategies can overcome difficulties in expressing and purifying functional recombinant MGR1?

Membrane proteins like MGR1 present significant expression and purification challenges. Implement these solutions:

  • Expression optimization:

    • Test multiple expression systems (E. coli, yeast, insect cells)

    • Optimize codon usage for the expression host

    • Try fusion tags that enhance solubility (MBP, SUMO, Trx)

    • Reduce expression temperature (16-18°C) to allow proper folding

    • Use controlled induction methods (auto-induction media, titrated inducers)

  • Membrane protein extraction:

    • Screen detergent panel (mild options: DDM, LMNG, GDN)

    • Test detergent-free methods (SMALPs, nanodiscs, amphipols)

    • Include lipids during solubilization to stabilize native structure

    • Optimize detergent:protein ratios systematically

  • Purification strategy:

    • Use tandem affinity tags for improved purity

    • Include stabilizers in all buffers (glycerol, specific lipids)

    • Minimize exposure to air (use degassed buffers, argon overlay)

    • Maintain constant temperature during purification

    • Reduce purification time to minimize degradation

  • Functional validation:

    • Develop activity assays applicable to detergent-solubilized protein

    • Use thermal shift assays to monitor protein stability

    • Assess oligomeric state by size exclusion chromatography

    • Verify correct folding by circular dichroism spectroscopy

When storing the purified protein, follow the recommended conditions: Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, and avoid repeated freeze-thaw cycles .

How can researchers troubleshoot issues in detecting protein-protein interactions involving MGR1?

Detecting protein-protein interactions with membrane proteins like MGR1 requires specialized troubleshooting:

  • Co-immunoprecipitation challenges:

    • Problem: Weak or undetectable interactions

    • Solutions:

      • Use membrane-compatible crosslinkers (DSS, DTSSP)

      • Optimize detergent conditions (test concentration series)

      • Include protease inhibitors and reduce experimental time

      • Try different antibody combinations and orientations

  • Yeast two-hybrid issues:

    • Problem: Membrane proteins often fail in conventional Y2H

    • Solutions:

      • Use split-ubiquitin membrane Y2H system

      • Test individual domains rather than full-length protein

      • Create soluble chimeras with essential interaction domains

      • Verify expression of bait and prey constructs

  • Proximity labeling troubleshooting:

    • Problem: High background or low specificity

    • Solutions:

      • Optimize labeling time (shorter for reduced background)

      • Include appropriate negative controls

      • Use ratiometric approaches with quantitative proteomics

      • Validate hits with orthogonal methods

  • Validation strategy:

    • Confirm interactions with multiple techniques

    • Demonstrate functional relevance of interactions

    • Map interaction domains through truncation analysis

    • Use point mutations to disrupt specific interactions

This systematic troubleshooting approach will help overcome the inherent difficulties in studying membrane protein interactions.

What experimental strategies can address challenges in identifying MGR1 substrates?

Identifying the complete substrate repertoire of MGR1 requires overcoming several technical challenges:

  • Substrate stabilization approaches:

    • Use protease-inactive Yme1 (E541Q) to trap substrates

    • Apply MG132 or bortezomib to inhibit proteasome for cytosolic domains

    • Combine MGR1 and MGR3 deletions for maximum substrate stabilization

    • Conduct experiments under stress conditions that may increase substrate load

  • Proteomics strategies:

    • Implement dynamic SILAC to measure protein turnover rates

    • Use TMT labeling for multiplexed comparison across conditions

    • Enrich for mitochondrial membrane proteins before analysis

    • Apply data-independent acquisition (DIA) for improved reproducibility

  • Candidate validation workflow:

    • Establish clear criteria for substrate identification:

      • Accumulation in Δmgr1 cells

      • Physical interaction with MGR1

      • Accelerated degradation when MGR1 is overexpressed

      • Dependence on Yme1 protease activity

    • Design targeted validation experiments for each candidate

  • Bioinformatic prediction:

    • Develop machine learning models trained on confirmed substrates

    • Identify shared sequence or structural features

    • Predict degrons or recognition motifs

    • Prioritize candidates based on prediction scores

By combining these approaches, researchers can overcome the challenges inherent in identifying the complete substrate spectrum of MGR1 and develop a comprehensive understanding of its role in mitochondrial protein quality control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.