Recombinant Debaryomyces hansenii Mitochondrial inner membrane magnesium transporter mrs2 (MRS2)

Shipped with Ice Packs
In Stock

Description

Discovery and Homologues

The MRS2 gene was initially identified in Saccharomyces cerevisiae and subsequently found in other organisms . The human homologue, hsaMRS2p, was identified and characterized as a candidate for a magnesium transporter in metazoa . MRS2 homologues have been identified and studied in various species, including:

  • Pongo abelii (Sumatran orangutan)

  • Rattus norvegicus (Rat)

  • Arabidopsis thaliana (Thale cress)

  • Schizosaccharomyces pombe (Fission yeast)

Structure and Function

MRS2 proteins typically contain two predicted transmembrane domains in their carboxyl terminus, with a conserved F/Y-G-M-N motif in the first domain, which is characteristic of the CorA family of magnesium transporters . MRS2 functions as a high-conductance magnesium-selective channel, facilitating magnesium influx into the mitochondrial matrix . Magnesium transport is crucial for various mitochondrial processes, including:

Functional Studies and Significance

Functional studies using mrs2-1 knockout mutant yeast have shown that expressing hsaMrs2p can restore mitochondrial magnesium concentrations and alleviate defects associated with the mutation, indicating that hsaMrs2p and yMrs2p are functional homologues . Direct magnesium uptake measurements in yeast mitochondria, using fluorescent dyes like mag-fura-2, have confirmed the role of MRS2 proteins in mediating magnesium transport across biological membranes .

Role in Disease

Mutations in the MRS2 gene can lead to significant physiological consequences. For example, a mutation in the rat MRS2 gene results in demyelination, highlighting the importance of MRS2 in maintaining neurological health .

Recombinant MRS2 Protein

Recombinant MRS2 protein is produced in E. coli and is used in various research applications . Key features of the recombinant MRS2 protein include:

  • Tag: Often fused with an N-terminal His tag for purification .

  • Purity: Typically greater than 90% as determined by SDS-PAGE .

  • Storage: Stored in Tris/PBS-based buffer with trehalose and glycerol to maintain stability .

Table 1: Recombinant MRS2 Protein Information from Different Species

FeaturePongo abeliiRattus norvegicusSchizosaccharomyces pombe
Protein LengthFull Length of Mature Protein (50-443 aa)Full Length of Mature Protein (29-434 aa)Full Length of Mature Protein (50-422 aa)
UniProt IDQ5R447Q9ET09P87149
AA SequenceRAAQLCEPGRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQELGLQARDLRFQHVMSITVRNNRIIMRMEYLKAVITPECLLILDYRNLNLEQWLFRELPSQLSGEGQLVTYPLPFEFRAIEALLQYWINTLQGKLSVLQPLILETLDALVDPKHSSVDKSKLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFINLGSHRNVMMRLNLQLTMGTFSLSLFGLMGVAFGMNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMA SLPKKTLLADRSMELKNSLRLDGLGSGRSILTNRSLAACCGRATPLTSGSQKAPSTPRTAGDVYRFRTSDASQATLASVAQVFAVTKFDKEGNVTSFERKKTELYHELALQARDLRFQHVMSITTRNNRIIMRMEYLKAVITPEYLLILDYRNLNLEHWLFRELPSQLAGEGQLVTYPLPFEFRAIEALLQYWINTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHVLLQNGKSLSELETDIKIFKESILELLDEEEMLEELCLTKWSDPHVFEQSSTGIDHAEEMELLLENYYRLADDLSNEARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSLSLFGLMGVAFGMNLESSLEEDHRVFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPVMASLPKKTLLADRRMDVKNSLRPEGLGAGRTILASRATDSNPLITGFPETSKNCPPSVAATKNRLLMNCTEFDDHGNVRVISGDFKKMDLCKQNGL LPRDLRKLNTSINSIVPVILVREGSILINLLHIRALIKANSVLLFDVYGSQHSHSQSQFI YELEGRLKQKSSDFGWLPYEMRALETILVSVVNTLDSELHVLHNLVSDLLADFELDINQE RLRTLLIFSKRLSGFLKKATLIRDVLDELLEQDQDLAGMYLTERLKTGKPRDLDKHDEVE LLLETYCKQVDEIVQQTDNLVGNIRSTEEICNIMLDANRNSLMLLGLKLSAMTLGLGFGA VVASLYGMNLQNGLENHPYAFYITTGSIFAFAAFLSSLGILKIRRLKRIQMALYHRCNLP ISLDPRSLRPPYL

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
MRS2; DEHA2B05566g; Mitochondrial inner membrane magnesium transporter MRS2; RNA-splicing protein MRS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-476
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
MRS2
Target Protein Sequence
SSGLSKQFFKYKSTVSRNQDILKKITDTNTHAMNTADIPEGISESFVDHQFEPNKLVPTN DKKIIYNRLKPITPNDSYVSCTIFDIKGNITAVSRKYPKMKFLKGNDLFPRDLRKIDTSS IDVVPSIMVRSPNCILVNLLHIKAIIKKDSVMVFDTSTPSIATKLGLFMYDLEMKLKLPS GNICYEFRALESILISVMSYLEADLRNHLQGCGLILAELEDEIDRNKLQDLLIKSKKLSS FYQKAVLIRNVLEELLDNDEDLAGMYLTDPIKFDPTIENPTDFADLEMMLESYYKQCDEF VQQAGSLINDIKATEEIVNIILDTNRNSLMLFELKITVYTLGFTVATLLPAFYGMNLKNY IEESTFGFGAVAVFSIIQGLLIIMLSFRKLRKVQKLTMMDGAGNHLHHSSSPIGLMNKDK WYYRLFYGNRHTKYDRPTPKESDVIWRMINDDKPLK
Uniprot No.

Target Background

Function

Recombinant Debaryomyces hansenii Mitochondrial Inner Membrane Magnesium Transporter mrs2 (MRS2)

MRS2 is a high-conductance magnesium-selective channel facilitating magnesium influx into the mitochondrial matrix. It plays a crucial role in mitochondrial mRNA group II intron splicing by modulating mitochondrial magnesium concentrations, which are essential for this process. Furthermore, MRS2 suppresses various mitochondrial intron mutations, and its absence can disrupt the assembly of mitochondrial membrane complexes.

Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii and why is it significant for MRS2 research?

Debaryomyces hansenii (also known as Candida famata) is a hemiascomycetous yeast commonly found in natural substrates, particularly in various types of cheese and high-salt environments. It belongs to the Saccharomycetaceae family and is significant for MRS2 research due to several characteristics:

  • It demonstrates exceptional osmotolerance, halotolerance and xerotolerance (can be cultivated in media with up to 25% NaCl or 18% glycerol)

  • It has considerable biotechnological potential as a stress-tolerant oleaginous microbe

  • Its MRS2 protein provides comparative insights into the evolutionary diversification of magnesium transport mechanisms across different organisms

The organism can survive in a pH range between 3 and 10, with its growth rate actually increasing in solutions with ≥1M NaCl or KCl. These characteristics make it an excellent model for studying membrane transporters under extreme conditions .

What is the structural composition of D. hansenii MRS2 protein?

The D. hansenii MRS2 protein is a mitochondrial inner membrane magnesium transporter with a complex protein structure. Based on analysis of amino acid sequences and structural studies, the protein contains:

  • A full-length sequence of 476 amino acids

  • The expression region spans amino acids 21-476

  • A characteristic N-terminal matrix domain

  • An α-helical domain extending into the inner membrane

  • An extensively elongated "stalk" helix that bridges the N-terminal matrix domain and the transmembrane pore

  • Two transmembrane helices (TM1 and TM2)

  • A GMN (Glycine-Methionine-Asparagine) motif within a short loop that constitutes the ion entryway

The protein shares structural homology with other members of the CorA-related magnesium transporter family, though with significant evolutionary adaptations specific to fungal systems. By comparison with human MRS2, which forms a pentameric channel architecture, the D. hansenii MRS2 likely assembles in a similar oligomeric state to create the functional ion conduction pathway .

How does D. hansenii MRS2 compare functionally to MRS2 proteins in other organisms?

D. hansenii MRS2 functions as a mitochondrial magnesium transporter but exhibits distinct properties compared to MRS2 homologs in other organisms:

OrganismChannel StructureIon SelectivityRegulation MechanismKey Structural Features
D. hanseniiLikely pentamericPrimarily Mg²⁺Not fully characterizedContains GMN motif; Specific matrix domain
Human MRS2PentamericNon-selective (Mg²⁺, Ca²⁺, Na⁺, K⁺)Ca²⁺-regulatedConserved arginine ring in pore; Distinct interfacial binding sites
Prokaryotic CorAPentamericHighly selective for Mg²⁺Mg²⁺-gatedDifferent interfacial Mg²⁺ binding sites
Yeast MRS2PentamericPrimarily Mg²⁺Multiple regulatory elementsCompact α/β domain

The human MRS2 protein differs functionally from prokaryotic orthologs like CorA, which operate as Mg²⁺-gated Mg²⁺ channels. Human MRS2 functions as a Ca²⁺-regulated, non-selective channel permeable to multiple cations. This functional divergence suggests that D. hansenii MRS2 may have evolved specialized regulatory mechanisms adapted to its extreme halotolerant lifestyle .

What are the optimal conditions for expressing recombinant D. hansenii MRS2 in heterologous systems?

Expressing recombinant D. hansenii MRS2 requires careful optimization of conditions:

Expression System Selection:

  • Bacterial systems (E. coli): Suitable for basic structural studies but may lack proper post-translational modifications

  • Yeast systems (S. cerevisiae or P. pastoris): Preferred for functional studies as they provide appropriate eukaryotic cellular machinery

  • Insect cell systems: Effective for obtaining higher yields of properly folded protein

Expression Protocol:

  • Clone the MRS2 gene (DEHA2B05566g) using PCR-based methods with 50bp homology flanks for efficient recombination

  • For optimal expression in yeast systems, use the following parameters:

    • Temperature: 25-28°C (lower than standard 30°C to improve protein folding)

    • Induction time: 16-24 hours

    • Media: YPD supplemented with 0.5M NaCl (leverages D. hansenii's halotolerance)

  • For membrane protein purification:

    • Use gentle detergents (DDM or LMNG) for solubilization

    • Include magnesium (5-10mM) in all buffers to maintain protein stability

    • Consider adding glycerol (10-15%) to prevent protein aggregation

When expressing the recombinant protein, targeting the region spanning amino acids 21-476 rather than the complete sequence improves expression yields while maintaining functional integrity . Additionally, incorporating a purification tag (His6 or Strep-tag) at the C-terminus rather than N-terminus minimizes interference with protein function.

What are the recommended methods for assessing the functional activity of recombinant D. hansenii MRS2?

To comprehensively assess the functional activity of recombinant D. hansenii MRS2:

Magnesium Transport Assays:

  • Mag-fura-2 Fluorescence Assay:

    • Reconstitute purified MRS2 in liposomes

    • Load liposomes with Mag-fura-2 (ratiometric Mg²⁺ indicator)

    • Monitor fluorescence ratio changes (340/380nm) upon addition of external Mg²⁺

    • Compare kinetics to known MRS2 transporters (t½ typically 5-15 minutes)

  • Radioactive ²⁸Mg Flux Measurements:

    • Incorporate MRS2 into proteoliposomes or use transfected cells

    • Add ²⁸Mg to external medium and measure uptake over time

    • Compare to mitochondrial uptake rates (typically >100-fold slower than Ca²⁺ uniporter)

  • Patch-Clamp Electrophysiology:

    • Express MRS2 in suitable cells (Xenopus oocytes recommended)

    • Apply voltage protocols to measure current-voltage relationships

    • Test for inhibition by known CorA inhibitors (cobalt hexammine at 0.3mM IC₅₀)

    • Assess ion selectivity by substituting different cations

Data Analysis Framework:

  • Calculate transport rates under varying conditions (Mg²⁺ concentrations, pH, presence of other ions)

  • Compare wild-type activity with mutant variants (particularly mutations in the GMN motif)

  • Assess ion selectivity by measuring transport of different cations (Ca²⁺, Mn²⁺, Co²⁺)

Based on studies of related transporters, functional D. hansenii MRS2 should demonstrate magnesium transport with distinct kinetics reflecting its adaptation to high-salt environments. When performing electrophysiological studies, mutations at key constriction sites (such as equivalent positions to R332 in human MRS2) can significantly enhance cation conduction .

How can gene targeting techniques be optimized for studying D. hansenii MRS2 function in vivo?

For effective gene targeting of MRS2 in D. hansenii:

PCR-Based Gene Targeting Protocol:

  • Design PCR primers with 50bp homology flanks matching sequences upstream and downstream of the MRS2 locus

  • Amplify a heterologous selectable marker cassette (Hygromycin B or G418 resistance) with these primers

  • Transform D. hansenii with the PCR product using the lithium acetate/PEG method (modified for high salt tolerance)

  • Select transformants on appropriate selective media

  • Confirm successful integration by colony PCR and sequencing

This method has demonstrated high efficiency (>75%) for gene targeting in wild-type D. hansenii isolates. The key innovation is using completely heterologous selectable markers with 50bp homology flanks, which has significantly improved gene targeting efficiency compared to previous methods .

Strategic Considerations:

  • For functional studies, consider creating point mutations in conserved regions (GMN motif, arginine ring) rather than complete gene disruption

  • For studying protein interactions, incorporate epitope tags (HA, FLAG) or fluorescent proteins (GFP variants)

  • When working with different D. hansenii isolates, be aware that some may require strain-specific optimization of transformation protocols

If complete knockout is not achievable, use a "safe harbor" integration approach for expressing modified versions of MRS2, which has been shown to be effective in D. hansenii isolates resistant to standard gene disruption .

What are the approaches for resolving contradictory data regarding ion selectivity of MRS2 transporters?

Resolving contradictory data regarding MRS2 ion selectivity requires a multi-faceted approach:

Methodological Considerations:

  • Controlled Comparative Analysis:

    • Perform parallel assays of D. hansenii MRS2 alongside human and yeast MRS2 under identical conditions

    • Use multiple complementary techniques (electrophysiology, fluorescence assays, isotope fluxes)

    • Standardize expression systems to eliminate system-specific artifacts

  • Site-Directed Mutagenesis Strategy:

    • Target key residues that differ between species-specific MRS2 proteins:

      • Focus on the conserved GMN motif (essential for Mg²⁺ selectivity)

      • Create mutations in the arginine ring region (critical for cation conduction)

      • Modify potential interfacial binding sites for regulatory ions

  • Advanced Structural Biology Approaches:

    • Perform cryo-EM analysis in various ionic conditions

    • Use molecular dynamics simulations to predict ion permeation pathways

    • Apply isothermal titration calorimetry to measure binding affinities for different ions

Reconciling Contradictory Models:
The conflict between the "Cl⁻-mediated Mg²⁺ transport" model and direct cation conduction models for MRS2 function can be addressed through mutations like R332S in human MRS2, which abolish Cl⁻ binding but enhance Mg²⁺ permeation . Similar strategic mutations in D. hansenii MRS2 can help determine whether its mechanism aligns more with the human or prokaryotic models.

A comprehensive approach that integrates structural, functional, and computational analyses is necessary to resolve these contradictions, as the evolutionary divergence between fungal, human, and prokaryotic magnesium transporters suggests potential functional adaptations specific to each organism's biology.

How does MRS2 function contribute to D. hansenii's exceptional halotolerance?

MRS2's role in D. hansenii halotolerance likely involves several interconnected mechanisms:

Proposed Mechanisms:

  • Specialized Magnesium Homeostasis:

    • Maintains optimal Mg²⁺ concentrations in mitochondria even under high salt stress

    • Supports mitochondrial ATP production under osmotic stress

    • Stabilizes ribosomes and other Mg²⁺-dependent cellular machinery

  • Mitochondrial Adaptation:

    • D. hansenii MRS2 may have evolved specialized regulation mechanisms compared to non-halotolerant yeasts

    • Potentially coordinates with Na⁺/H⁺ exchangers to maintain ion gradients

    • Could exhibit altered ion selectivity favoring Mg²⁺ transport even in high-Na⁺ environments

  • Energetic Considerations:

    • Enables efficient energy metabolism under stress conditions

    • Supports mitochondrial function when cytosolic ion concentrations are perturbed

    • May participate in osmoadaptation signaling networks

D. hansenii can grow in media containing up to 25% NaCl and shows increased growth rates in solutions with ≥1M NaCl or KCl, with sodium and potassium ions playing critical roles in maintaining osmobalance . MRS2's function in mitochondrial magnesium transport likely constitutes an important component of this exceptional salt tolerance.

What is the current understanding of D. hansenii MRS2's role in pathogenicity versus potential probiotic applications?

The dual nature of D. hansenii as both potential pathogen and probiotic presents a complex picture for MRS2 research:

Pathogenicity Context:
D. hansenii has been implicated in human infections, though it is frequently misidentified and may be less common as a pathogen than previously thought . It accounts for up to 2% of invasive candidiasis cases and has been found in Crohn's disease ulcerations . MRS2's potential role in pathogenicity might include:

  • Supporting fungal survival in host tissues by maintaining mitochondrial function

  • Contributing to stress resistance during host-pathogen interactions

  • Potentially affecting virulence factor expression through metabolic regulation

Probiotic Applications:
Certain strains of D. hansenii have been researched for probiotic potential . In this context, MRS2 might contribute to:

  • Stress tolerance during gastrointestinal transit

  • Metabolic activities that influence interactions with host microbiota

  • Production of beneficial metabolites dependent on mitochondrial function

Research Direction Framework:

  • Compare MRS2 sequence and expression between pathogenic and beneficial strains

  • Assess whether MRS2 function differs between strains isolated from different sources

  • Evaluate if MRS2 activity correlates with:

    • Ability to repair intestinal mucosa structure

    • Growth of beneficial lactase-producing bacteria

    • Antagonistic activity against pathogenic microorganisms

Studies show D. hansenii may be effective in treating antibiotic-associated diarrhea by promoting the growth of key lactase-producing bacteria . Understanding MRS2's contribution to these beneficial effects versus potential pathogenicity requires strain-specific functional studies.

How do evolutionary adaptations in D. hansenii MRS2 differ from other fungal and mammalian MRS2 proteins?

The evolutionary adaptations in D. hansenii MRS2 reflect its specialized ecological niche:

Comparative Evolutionary Analysis:

FeatureD. hansenii MRS2Other Fungal MRS2Human MRS2Prokaryotic CorA
N-terminal domainLikely adapted for salt toleranceVariable between speciesCompact α/β domainLarger cytoplasmic domain
Ion selectivity filterGMN motif (conserved)GMN motif (conserved)GMN motif (conserved)GMN motif
Regulatory sitesPotentially unique interfacial sitesSpecies-specific variationsDistinct interfacial Mg²⁺ binding siteDifferent interfacial sites
Arginine ringLikely presentVariable presenceConserved R332Absent
Transmembrane organizationLikely 2 TM helices2 TM helices2 TM helices2 TM helices

Significant Evolutionary Adaptations:

  • D. hansenii MRS2 likely contains specialized domains adapted for function in high-salt environments

  • The interfacial binding sites for regulatory ions may have evolved differently from those in other fungi and mammals

  • The protein may have developed unique structural features that maintain function during osmotic stress

These adaptations reflect D. hansenii's evolution in environments with extreme osmotic conditions. The conservation of core structural elements (GMN motif, transmembrane organization) alongside specialized adaptations highlights the balance between maintaining fundamental transport mechanisms and developing niche-specific modifications .

What advanced structural biology techniques are most promising for elucidating the complete ion permeation mechanism of D. hansenii MRS2?

Resolving the complete ion permeation mechanism requires integrated cutting-edge approaches:

Advanced Structural Biology Workflow:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Determine high-resolution structures (≤3Å) in different conformational states

    • Capture protein in various ion-bound states (Mg²⁺, Ca²⁺, Na⁺)

    • Use directed evolution to stabilize key intermediates

    • Apply time-resolved cryo-EM to capture transient states

  • Molecular Dynamics Simulations:

    • Perform microsecond-scale simulations of ion permeation

    • Calculate free energy profiles for different ions along the conduction pathway

    • Model effects of osmotic stress on channel gating

    • Simulate impact of high salt concentrations on protein dynamics

  • Advanced Spectroscopic Methods:

    • Apply solid-state NMR to probe dynamic regions

    • Use site-directed spin labeling with EPR to measure conformational changes

    • Implement FRET sensors to monitor real-time structural transitions

    • Utilize HDX-MS to identify regions with altered dynamics during transport

  • Functional Correlation Studies:

    • Design chimeric constructs swapping domains between D. hansenii, human, and other fungal MRS2 proteins

    • Create libraries of point mutations at key residues identified in structural studies

    • Employ deep mutational scanning to comprehensively map structure-function relationships

The arginine ring that creates a constriction site in human MRS2 (at position R332) significantly impacts ion conductance, with mutations like R332S greatly facilitating cation conduction . Identifying and characterizing equivalent structures in D. hansenii MRS2 will be crucial for understanding its unique permeation mechanism.

What are the major technical challenges in studying D. hansenii MRS2 and how can they be overcome?

Researchers face several significant challenges when studying D. hansenii MRS2:

Challenge 1: Expression and Purification Difficulties

  • Problem: Membrane proteins like MRS2 often express poorly and aggregate during purification

  • Solution Approach:

    • Use specialized expression systems (Pichia pastoris, insect cells)

    • Apply fusion tags that enhance stability (BRIL, T4 lysozyme)

    • Develop nanodiscs or SMALP approaches for native-like membrane environments

    • Optimize detergent selection based on systematic screening

Challenge 2: Functional Assay Limitations

  • Problem: Traditional assays may not accurately capture the unique properties of D. hansenii MRS2

  • Solution Approach:

    • Develop high-salt compatible assay systems

    • Create specialized liposome compositions mimicking D. hansenii membranes

    • Implement real-time imaging of ion transport in live cells

    • Design genetically-encoded sensors specific for mitochondrial compartments

Challenge 3: Genetic Manipulation Constraints

  • Problem: Despite recent advances, genetic manipulation of D. hansenii remains challenging

  • Solution Approach:

    • Further refine PCR-based gene targeting with heterologous selection markers

    • Develop CRISPR-Cas9 systems optimized for D. hansenii

    • Create conditional expression systems for essential genes

    • Establish robust protocols for site-specific integration

Challenge 4: Physiological Relevance Assessment

  • Problem: Connecting biochemical findings to organismal physiology is complex

  • Solution Approach:

    • Develop stress-responsive reporter systems in D. hansenii

    • Create in vivo imaging approaches for mitochondrial function

    • Establish metabolomic profiling under various stress conditions

    • Design competition assays to measure fitness effects of MRS2 variants

These methodological advances will enable researchers to overcome the current limitations in studying this challenging but important membrane transporter.

What are the most promising research directions for understanding the relationship between D. hansenii MRS2 function and applications in biotechnology?

Future research on D. hansenii MRS2 offers several promising directions:

Fundamental Research Priorities:

  • Structure-Function Relationships:

    • Determine how D. hansenii MRS2 structure facilitates function in high-salt environments

    • Identify regulatory mechanisms that coordinate transport with metabolic needs

    • Map the complete ion permeation pathway using complementary structural techniques

  • Systems Biology Integration:

    • Characterize the MRS2 interactome in D. hansenii mitochondria

    • Develop comprehensive models of mitochondrial ion homeostasis

    • Understand coordination between MRS2 and other transporters during stress

Translational Research Opportunities:

  • Strain Engineering Applications:

    • Engineer MRS2 variants with enhanced properties for biotechnological applications

    • Develop D. hansenii strains with optimized mitochondrial function for bioproduction

    • Create synthetic biology tools based on MRS2 regulation mechanisms

  • Biomedical Applications:

    • Explore the relationship between MRS2 function and D. hansenii's effects in intestinal health

    • Investigate potential probiotic applications based on beneficial strains

    • Develop targeted approaches to inhibit pathogenic strains while preserving beneficial ones

  • Industrial Biotechnology:

    • Harness D. hansenii's exceptional stress tolerance for sustainable bioprocesses

    • Develop MRS2-optimized strains for extreme fermentation conditions

    • Create biosensors based on MRS2 for monitoring environmental magnesium

The unique adaptations of D. hansenii MRS2 may provide valuable insights for both fundamental science and applied research, particularly in understanding how membrane transporters function under extreme conditions. Integrating structural biology, genetics, and systems approaches will be essential for realizing the full potential of this research area.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.