Recombinant Debaryomyces hansenii Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

Shipped with Ice Packs
In Stock

Description

Introduction

Mitochondrial intermembrane space import and assembly protein 40 (MIA40), also known as TIM40, is a crucial protein in the mitochondrial intermembrane space (IMS) that plays a vital role in oxidative protein folding . It facilitates the import and assembly of proteins into the IMS of mitochondria . MIA40 acts as an oxidoreductase, catalyzing the formation of disulfide bonds in substrate proteins, which is essential for their proper folding and function . Debaryomyces hansenii is a yeast species in which MIA40 has been identified and studied . Recombinant MIA40 refers to the protein produced using recombinant DNA technology, allowing for detailed biochemical and structural studies .

Mechanism of Action

MIA40 functions as a catalyst in oxidative folding by transiently binding substrate proteins and facilitating disulfide bond formation. The current understanding supports a model where MIA40 induces the formation of secondary structural elements, thereby guiding the folding of the substrate .

  1. Substrate Recognition: MIA40 recognizes and binds to the internal targeting signals (ITS) on the substrate protein .

  2. Initial Folding: The binding of MIA40 induces the folding of one helix of the ITS, which acts as the crucial folding nucleus .

  3. Disulfide Bond Formation: Following the initial folding, MIA40 catalyzes the formation of a disulfide bond within the substrate protein .

  4. Chaperone Activity: MIA40 acts as a chaperone foldase, assisting in the hydrophobic collapse and subsequent cooperative folding steps of the substrate to its native state .

Role in Protein Import

MIA40 is essential for importing proteins into the mitochondrial IMS . It primarily acts as a trans-site receptor, binding incoming proteins via hydrophobic interactions, which drives protein translocation across the outer membrane . This 'holding trap' mechanism facilitates the import of proteins independently of the oxidation process .

Interaction with Apoptosis-Inducing Factor 1 (AIFM1)

Recent studies indicate that MIA40 interacts with Apoptosis-Inducing Factor 1 (AIFM1), suppressing AIFM1-induced cell death in an NADH-dependent manner .

  • Complex Formation: MIA40 forms a complex with AIFM1, where the N-terminal domain of MIA40 interacts with the C-terminal domain of AIFM1, forming an extended β-sheet .

  • Stabilization of AIFM1 Dimer: MIA40 contributes to the formation and stabilization of the AIFM1 dimer, concealing the nuclear localization signal (NLS) of AIFM1 .

  • Modulation of Cell Death: By stabilizing the AIFM1 dimer, MIA40 reduces the activity of AIFM1, preventing premature cell death upon complex I impairment and increased NADH/NAD+ balance .

Clinical Significance

The role of MIA40 in modulating AIFM1-induced cell death has potential implications for cancer research. Cancers exhibiting high NADH/NAD+ ratios may be susceptible to therapies targeting the MIA40-AIFM1 interaction . Additionally, MIA40 is crucial for importing subunits of complex I, and its dysfunction is linked to metabolic stress and various pathological conditions .

Experimental Data

FeatureDescription
Protein NameMitochondrial intermembrane space import and assembly protein 40 (MIA40)
SpeciesDebaryomyces hansenii
UniProt IDQ6BSK8
Molecular WeightNot specified
Key DomainsN-terminal CPC motif, C-terminal hydrophobic pocket
FunctionOxidative protein folding, protein import into mitochondrial IMS, suppression of AIFM1-induced cell death
Role in DiseaseLinked to metabolic stress, complex I impairment, and potential cancer implications
Interacting ProteinsAIFM1, Erv1, complex I subunits (NDUFS5, NDUFB7, NDUFA8)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIA40; TIM40; DEHA2D08096g; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-249
Protein Length
Full Length of Mature Protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
MIA40
Target Protein Sequence
SNQGFRAAKASKTNMYLGAGIALIPVIMSINYLNGNHIANEVDENKVEEGKKKAESTGKK EFVEKAEKEAIGKADVKTKVPAEEANPETRTETDKPSEESQKDEENSYEGAAYNPETGEI NWDCPCLGGMAHGPCGEEFKEAFACFIYSESEPKGIECIKKFESMRNCFREHPEHYKEEL YDDEEQEPLVDVNEKKGDASEQSAETIADDATKVVKEKAKAEDSNTK
Uniprot No.

Target Background

Function

Essential for the import and folding of small cysteine-containing proteins (small Tims) within the mitochondrial intermembrane space (IMS). MIA40 participates in a redox cycle with ERV1, utilizing a disulfide relay system. Precursor proteins destined for the IMS are translocated in their reduced state into the mitochondria. Oxidized MIA40 forms a transient disulfide bond with the reduced precursor protein, oxidizing the precursor and enabling its subsequent folding within the IMS with an intramolecular disulfide bond.

Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

Basic Research Questions

  • What is the functional role of MIA40 in D. hansenii mitochondria?

    MIA40 in D. hansenii functions as a central component of the mitochondrial intermembrane space (IMS) protein import machinery. Research indicates that MIA40 serves primarily as a trans-site receptor that binds incoming proteins via hydrophobic interactions, thereby mediating protein translocation across the outer membrane.

    MIA40 contains two functional elements:

    • An N-terminal cysteine-proline-cysteine motif conferring substrate oxidation

    • A C-terminal hydrophobic pocket for substrate binding

    Experimental evidence from yeast mutant studies shows that the substrate-binding domain of MIA40 is both necessary and sufficient to promote protein import, indicating that trapping by MIA40 drives protein translocation through a "holding trap" rather than a "folding trap" mechanism .

  • How does D. hansenii MIA40 compare to MIA40 homologs in other yeast species?

    D. hansenii MIA40 shares conserved features with MIA40 proteins from other yeast species, particularly in the C-terminal domain containing six conserved cysteines. The four C-terminal cysteines form a twin Cx9C motif which is also found in other IMS proteins like Cox17 and Cox19 .

    When comparing D. hansenii MIA40 to Saccharomyces cerevisiae MIA40:

    FeatureD. hansenii MIA40S. cerevisiae MIA40
    Domain structureContains conserved C-terminal domain with six cysteinesSimilar conserved domain structure
    Essential natureEssential protein for cell viabilityEssential protein for cell viability
    Substrate specificityBinds to small IMS proteinsBinds to small IMS proteins including Tim9, Tim10
    Sequence characteristicsHigh content of negatively charged residuesHigh content of negatively charged residues

    Understanding these similarities is crucial for researchers utilizing D. hansenii as a model organism for studying MIA40 function in halotolerant conditions .

  • What are the experimental approaches to study D. hansenii MIA40 expression systems?

    To study D. hansenii MIA40 expression, researchers typically employ the following methodological approaches:

    • Plasmid Construction: Utilizing PCR-based gene targeting with 50 bp homologous flanks for efficient gene integration (>75% efficiency) .

    • Selectable Markers: Implementation of heterologous selectable marker cassettes that confer Hygromycin B or G418 resistance to D. hansenii transformants .

    • Expression Systems: Recently developed CRISPR-CUG/Cas9 toolbox for D. hansenii allows precise genetic modifications .

    • In vivo DNA Assembly: Up to three different DNA fragments with 30-bp homologous overlapping overhangs can be co-transformed and fused in the correct order in a single step .

    • Promoter Selection: The TEF1 promoter (from Arxula adeninivorans) has shown highest production efficiency for recombinant proteins in D. hansenii .

    These approaches provide researchers with multiple options for expressing and studying recombinant MIA40 in D. hansenii under various experimental conditions.

  • What growth conditions are optimal for D. hansenii cultures expressing recombinant MIA40?

    D. hansenii exhibits unique growth characteristics that affect recombinant protein expression:

    • Salt Conditions: D. hansenii thrives in high salt environments (up to 4M NaCl), which can be exploited to create selective growth conditions. Higher salt concentrations (1.1-2.2%) can enhance growth rates and improve feed conversion ratios .

    • Temperature Range: The yeast tolerates a wide temperature range, with optimal growth typically between 20-30°C for recombinant protein expression .

    • Carbon Sources: D. hansenii can metabolize various carbon sources beyond glucose, including lactose and glycerol, making it suitable for growth on industrial by-products .

    • pH Tolerance: Exhibits growth across a broad pH spectrum, which allows flexibility in cultivation conditions .

    • Non-sterile Conditions: Remarkably, D. hansenii can be cultivated in non-sterile conditions when using high-salt media, as it outcompetes other microorganisms, making it ideal for industrial applications .

    A methodological approach involves monitoring growth not only through optical density but also through the production of fluorescent proteins (like YFP) that can specifically track D. hansenii growth in mixed cultures .

Advanced Research Questions

  • What experimental designs can distinguish between MIA40's receptor function and its oxidase activity?

    Distinguishing between MIA40's dual functions requires sophisticated experimental designs:

    • Domain-Specific Mutagenesis: Generate mutants that selectively disrupt either:

      • The CPC motif (oxidase function) - create SPS motif mutants

      • The hydrophobic binding pocket (receptor function)

    • Complementation Assays: Use oxidase-deficient mutants (like MIA40-SPS) with chemical oxidants such as diamide to partially rescue function, demonstrating the primary importance of receptor function .

    • In vitro Reconstitution: Purify recombinant wild-type and mutant MIA40 proteins to assess their binding and oxidation capabilities separately.

    • Import Assays with Redox Controls: Perform protein import assays under varying redox conditions to assess receptor-only function:

      • Reduced glutathione (to inhibit oxidation)

      • DTT (to maintain substrates in reduced state)

      • Anaerobic conditions (to prevent reoxidation)

    • Quantitative Binding Analysis: Use techniques like isothermal titration calorimetry or surface plasmon resonance to measure binding affinities independent of oxidation.

    Research has shown that an oxidase-deficient MIA40 mutant is inviable but can be partially rescued by diamide, supporting that MIA40 predominantly functions as a trans-site receptor .

  • How can researchers assess the impact of D. hansenii's halotolerance on MIA40 function?

    Investigating how halotolerant environments affect MIA40 function requires systematic approaches:

    • Comparative Analysis: Express D. hansenii MIA40 and homologs from non-halotolerant yeasts (e.g., S. cerevisiae) in the same system to compare stability and function under varying salt concentrations.

    • Salt-Gradient Experiments: Assess protein import efficiency across a range of salt concentrations (0-4M NaCl) to establish dose-response relationships between salt concentration and MIA40 activity.

    • Structural Analysis: Use circular dichroism spectroscopy and thermal shift assays to determine whether high salt alters MIA40's secondary structure or thermal stability.

    • Substrate Specificity Shifts: Examine whether high salt conditions alter the substrate preference of MIA40 through comparative proteomics of the mitochondrial IMS under different salt conditions.

    • Salt-Adapted Mutants: Generate and characterize MIA40 variants with enhanced function in high-salt environments through directed evolution approaches.

    • Metabolic Impact Assessment: Investigate whether salt-induced metabolic changes in D. hansenii affect the redox environment of the IMS, thereby indirectly influencing MIA40 function.

    These approaches will help elucidate whether D. hansenii MIA40 has evolved specific adaptations for function in high-salt environments.

  • What strategies can overcome challenges in purifying active recombinant D. hansenii MIA40?

    Purifying active MIA40 presents significant challenges due to its disulfide-rich nature and membrane association. Researchers can employ these strategies:

    • Expression System Selection: Compare expression in bacterial (E. coli), yeast (P. pastoris), and insect cell systems to identify optimal conditions for soluble protein production.

    • Fusion Tags: Utilize solubility-enhancing fusion partners:

      • N-terminal: MBP (maltose-binding protein) or SUMO

      • C-terminal: His6 tag with linker to prevent interference with the functional domains

    • Redox Buffer Optimization: Maintain appropriate redox conditions during purification:

      • Include optimal GSH:GSSG ratios to maintain native disulfide bonds

      • Add low concentrations of reducing agents to prevent non-native disulfide formation

    • Detergent Screening: Systematically test detergents for membrane-associated regions:

      • Mild detergents: DDM, LMNG, or digitonin

      • Detergent screening kits to identify optimal solubilization conditions

    • On-column Refolding: For inclusion body purification, develop on-column refolding protocols with gradually decreasing denaturant concentrations.

    • Activity Verification: Establish robust assays to verify that purified MIA40 retains:

      • Substrate binding activity (using fluorescence anisotropy with labeled peptides)

      • Oxidoreductase activity (using redox-sensitive fluorescent probes)

    These approaches should be systematically evaluated to develop an optimized purification protocol.

  • How do mutations in the CPC motif versus the hydrophobic binding pocket differentially affect MIA40 function?

    Research distinguishing the effects of mutations in different MIA40 domains reveals:

    Domain MutatedImport CapacityOxidation FunctionViabilityRescue Method
    CPC motif (to SPS)MaintainedSeverely impairedNon-viable alonePartially rescued by chemical oxidants (diamide)
    Hydrophobic pocketSeverely impairedMaintainedNon-viableCannot be rescued by oxidants

    Experimental approaches to characterize these mutations include:

    • Domain Swapping: Creating chimeric proteins with domains from different species to identify species-specific functional elements.

    • Disulfide Mapping: Using mass spectrometry to track the formation of disulfide bonds in substrates when interacting with different MIA40 mutants.

    • Real-time Import Kinetics: Measuring the rate of precursor disappearance from the cytosolic fraction combined with appearance in the IMS to distinguish between import defects and folding/oxidation defects.

    • Substrate Range Analysis: Determining whether mutations differentially affect the import of various substrates, potentially revealing substrate-specific dependencies on different MIA40 domains.

    Research has demonstrated that the substrate-binding domain of MIA40 is both necessary and sufficient to promote protein import, indicating that binding-mediated trapping drives protein translocation as the primary function .

  • What methods can elucidate the complete substrate spectrum of D. hansenii MIA40?

    To comprehensively characterize MIA40 substrates in D. hansenii, researchers can employ these advanced methodologies:

    • Proximity Labeling Proteomics: Use BioID or APEX2 fused to MIA40 to biotinylate proteins in close proximity, followed by streptavidin pulldown and mass spectrometry.

    • Cysteine-Trapping Mutants: Generate MIA40 variants with trap mutations (e.g., CXXC to CXXA) that form stable mixed disulfides with substrates, allowing isolation of covalent MIA40-substrate complexes.

    • Comparative Depletion Proteomics: Analyze changes in the mitochondrial proteome upon conditional depletion of MIA40, focusing on IMS proteins.

    • In Organello Import Screens: Create a library of potential IMS precursor proteins and systematically test their import dependence on MIA40 using isolated mitochondria.

    • Redox Proteomics: Apply techniques like OxICAT or redox DIGE to identify proteins undergoing MIA40-dependent oxidation.

    • Affinity Purification Coupled with Crosslinking: Use chemical crosslinkers to stabilize transient MIA40-substrate interactions followed by tandem mass spectrometry.

    Research in S. cerevisiae has shown that MIA40 depletion affects not only direct substrates but also proteins like cytochrome b2, whose biogenesis depends on MIA40 substrates involved in processing complexes .

  • How can researchers establish reliable in vitro reconstitution systems for D. hansenii MIA40 activity?

    Creating functional in vitro systems to study MIA40 activity requires careful consideration of several factors:

    • Protein Components:

      • Purified recombinant MIA40 (wild-type and mutant variants)

      • Candidate substrate proteins in reduced state

      • Purified Erv1/ALR (the sulfhydryl oxidase partner of MIA40)

      • Cytochrome c (as final electron acceptor)

    • Buffer Optimization:

      • Redox buffer system (GSH/GSSG at physiological ratios)

      • Salt concentration relevant to D. hansenii's natural environment

      • pH range compatible with both MIA40 activity and substrate stability

    • Assay Design:

      • Monitor substrate oxidation using maleimide-based fluorescent probes

      • Track oxygen consumption as measure of completed electron transfer chain

      • Use gel-shift assays to visualize formation of intramolecular disulfides

    • Controls:

      • Parallel reactions with S. cerevisiae MIA40 to benchmark activity

      • Include catalytically inactive MIA40 variants as negative controls

      • Test the system with known strong substrates (Tim9/10) and weak substrates

    • Kinetic Analysis:

      • Determine reaction rates under varying substrate and enzyme concentrations

      • Establish whether the D. hansenii system follows Michaelis-Menten kinetics

      • Analyze the effect of salt concentration on reaction kinetics

    Such a reconstituted system would allow detailed mechanistic studies of the unique properties of D. hansenii MIA40 in a controlled environment.

  • What are effective approaches to study the interplay between MIA40 and the MICOS complex in D. hansenii?

    Research suggests that the MICOS complex may tether MIA40 to specific subpopulations of the TOM complex, creating discrete import sites . To investigate this interaction in D. hansenii:

    • Co-immunoprecipitation Studies:

      • Use tagged versions of MIA40 and MICOS components to detect physical interactions

      • Perform reciprocal pulldowns under varying salt conditions to test interaction strength

      • Apply crosslinking prior to pulldown to capture transient interactions

    • Super-resolution Microscopy:

      • Employ techniques like PALM or STORM to visualize co-localization of MIA40 with MICOS and TOM components

      • Perform dual-color imaging to track dynamic associations during protein import

    • Genetic Interaction Analysis:

      • Create conditional mutants of both MIA40 and MICOS components

      • Test for synthetic growth defects that would indicate functional relationships

      • Perform suppressor screens to identify compensatory mutations

    • In Organello Import Studies:

      • Compare import efficiency in mitochondria with intact versus disrupted MICOS

      • Analyze whether MICOS disruption specifically affects MIA40-dependent import

    • Cryo-electron Tomography:

      • Visualize the spatial organization of import sites at mitochondrial membrane contact sites

      • Compare the distribution of MIA40 relative to TOM and MICOS in wild-type and mutant mitochondria

    These approaches would help elucidate whether the MIA40-MICOS interaction represents a conserved feature across yeast species and has specific adaptations in D. hansenii.

  • How does overexpression of MIA40 in D. hansenii affect mitochondrial proteostasis and cell physiology?

    Research indicates that MIA40 levels are rate-limiting for the import of IMS proteins . To investigate the consequences of MIA40 overexpression:

    • Quantitative Proteomics:

      • Compare the mitochondrial proteome under native and MIA40 overexpression conditions

      • Focus on changes in the stoichiometry of IMS protein complexes

      • Identify proteins whose abundance is most sensitive to MIA40 levels

    • Respiratory Chain Analysis:

      • Measure oxygen consumption rates and respiratory control ratios

      • Assess activity of individual respiratory chain complexes

      • Evaluate ATP production capacity under different metabolic conditions

    • Redox Homeostasis Evaluation:

      • Measure mitochondrial and cytosolic redox status using redox-sensitive GFP variants

      • Assess glutathione redox state in different cellular compartments

      • Test resistance to oxidative stress inducers

    • Growth Analysis Under Stress:

      • Evaluate growth parameters under varying salt concentrations

      • Test resistance to temperature stress and respiratory inhibitors

      • Assess chronological lifespan under different growth conditions

    • Mitochondrial Morphology:

      • Examine mitochondrial network structure using fluorescence microscopy

      • Assess mitochondrial membrane potential using potential-sensitive dyes

      • Evaluate mitochondrial dynamics (fusion/fission rates)

    Studies in S. cerevisiae have shown that MIA40 overexpression can significantly increase levels of IMS proteins, including those not directly imported by MIA40, suggesting broad effects on mitochondrial biogenesis .

  • What strategies can effectively combine gene targeting approaches with MIA40 functional studies in D. hansenii?

    Recent advances in genetic manipulation of D. hansenii open new possibilities for MIA40 research:

    • PCR-based Gene Targeting:

      • Utilize the efficient homologous recombination system (>75% efficiency with just 50 bp flanks)

      • Generate precise point mutations to target specific functional domains of MIA40

      • Create conditional alleles using regulatable promoters

    • CRISPR-CUG/Cas9 System:

      • Apply the recently developed CRISPR system specialized for D. hansenii

      • Generate multiple mutations simultaneously to study genetic interactions

      • Create scarless mutations to avoid effects of marker genes

    • In vivo DNA Assembly:

      • Utilize D. hansenii's ability to assemble up to three DNA fragments with 30-bp homologous overlaps

      • Create complex expression constructs for structure-function studies

      • Develop reporter systems for MIA40 activity

    • Safe Harbor Integration:

      • Identify genomic "safe harbor" sites for controlled expression of MIA40 variants

      • Use constitutive versus inducible promoters to control expression levels

      • Create strain collections with systematically varying MIA40 expression levels

    • Complementation Testing:

      • Express MIA40 variants in heterologous systems to test cross-species functionality

      • Use lethal MIA40 mutations complemented by plasmid-borne wild-type copies for plasmid shuffle assays

    These approaches provide powerful tools to dissect MIA40 function in vivo, particularly in the context of D. hansenii's unique halotolerant physiology.

  • How can researchers investigate the impact of MIA40 mutations on proteotoxic stress responses in D. hansenii?

    Studies in S. cerevisiae have shown that MIA40 function affects cellular resistance to proteotoxic stress . To examine this in D. hansenii:

    • Aggregation Models:

      • Express aggregation-prone proteins (like polyQ-containing proteins) in cells with wild-type and mutant MIA40

      • Assess the formation of protein aggregates using biochemical fractionation and microscopy

      • Measure the solubility of endogenous aggregation-prone proteins

    • Heat Shock Response:

      • Monitor expression of heat shock proteins under basal and stress conditions

      • Assess activation of heat shock transcription factors

      • Measure thermotolerance in MIA40 variants

    • Unfolded Protein Response:

      • Evaluate activation of mitochondrial unfolded protein response markers

      • Assess ER unfolded protein response as an indicator of cellular proteostasis

      • Measure sensitivity to ER stress inducers like tunicamycin

    • Proteasome Activity:

      • Measure ubiquitin-proteasome system activity using fluorogenic substrates

      • Assess levels of ubiquitinated proteins in different cellular compartments

      • Test sensitivity to proteasome inhibitors

    • Autophagy/Mitophagy:

      • Monitor markers of general autophagy and selective mitophagy

      • Assess turnover of mitochondrial proteins under stress conditions

      • Evaluate the impact of autophagy inducers and inhibitors

    Research indicates that increased levels of MIA40 can prevent the aggregation of cytosolic proteins and enhance resistance to proteotoxic stress , suggesting an unexplored role in cellular proteostasis maintenance.

  • What experimental approaches can reveal the potential biotechnological applications of recombinant D. hansenii MIA40?

    D. hansenii's unique properties make it promising for biotechnological applications . To explore MIA40's role:

    • Bioproduction in Harsh Environments:

      • Assess whether MIA40 overexpression enhances D. hansenii growth in industrial by-products

      • Test growth and protein production capacity in high-salt dairy waste streams

      • Evaluate MIA40's role in stress tolerance during industrial fermentation

    • Recombinant Protein Production:

      • Develop MIA40-based systems for enhanced production of disulfide-rich proteins

      • Test whether MIA40 co-expression improves folding and secretion of heterologous proteins

      • Compare production yields in conventional versus salt-rich industrial media

    • Non-sterile Cultivation:

      • Investigate whether MIA40 contributes to D. hansenii's ability to outcompete contaminating microorganisms

      • Optimize cultivation parameters for recombinant protein production in open (non-sterile) conditions

      • Assess performance in bioreactors using untreated industrial waste streams

    • Biosensor Development:

      • Create MIA40-based biosensors for monitoring redox conditions in industrial processes

      • Develop reporter systems that respond to environmental stressors

      • Engineer D. hansenii strains with enhanced sensing capabilities for bioprocess monitoring

    Research demonstrates that D. hansenii can grow and produce recombinant proteins in open, non-sterile cultivations using salt-rich industrial by-products , opening new avenues for sustainable bioprocessing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.