Recombinant Debaryomyces hansenii Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

Shipped with Ice Packs
In Stock

Description

Gene and Functional Context

  • Gene Locus: DEHA2E10428g, located on chromosome E in D. hansenii (strain ATCC 36239/CBS 767) .

  • Function: Mediates ATP-dependent uptake of TPP into mitochondria, essential for acetyl-CoA synthesis and citric acid cycle enzymes .

  • Orthologs: Homologs exist in Saccharomyces cerevisiae (TPC1) and Lodderomyces elongisporus (LELG_01926), highlighting evolutionary conservation of TPP transport mechanisms .

Biotechnological Applications

Recombinant TPC1 is utilized in:

  • Metabolic Engineering: Enables studies on mitochondrial TPP dynamics in halotolerant yeasts, aiding industrial applications in high-stress environments .

  • Enzyme Assays: Serves as a reference protein for quantifying TPP transport efficiency in synthetic biology platforms .

  • Drug Discovery: Potential target for antifungal agents, given TPP’s role in fungal metabolism .

Key Studies

  1. Functional Characterization: Heterologous expression in S. cerevisiae confirmed TPC1’s role in TPP transport, with kinetic studies revealing substrate specificity .

  2. Salt Tolerance: Multi-omics analyses of D. hansenii under saline stress suggest TPC1 upregulation supports metabolic adaptation, though direct evidence remains under investigation .

  3. CRISPR-Based Engineering: High-efficiency gene targeting methods (e.g., PCR-mediated homologous recombination) enable precise TPC1 modification in wild-type D. hansenii strains .

Comparative Kinetics

OrganismTransport ActivityKm (TPP)Reference
D. hansenii (TPC1)ATP-dependentNot reported
S. cerevisiae (TPC1)Proton-coupled symport~0.2 mM

Challenges and Future Directions

  • Structural Resolution: No crystal structure is available; molecular dynamics simulations are needed to elucidate transport mechanisms .

  • Industrial Scaling: Optimization of recombinant production in cost-effective systems (e.g., Pichia pastoris) is ongoing .

  • Pathogenicity Links: TPC1’s role in D. hansenii-associated infections (e.g., Crohn’s disease) warrants further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TPC1; DEHA2E10428g; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
TPC1
Target Protein Sequence
MNAASDTSSGRENHLKKGSKVSPYEALIAGSLSGAIARGIIAPLDTIKIRLQLQIQGYDT YKGASKTFVSICKNEGVKALWKGNVPAEILYILYGAIQFTSYSALSKALSEFEKNNRNLF TISNSTHSLIAGSGSGLASTFFTYPFDLLRTRLAANSEAHFLSMSSTIKSIYEMHGIGGF CKGLTPGLLSVASSTGLMFWSYELAREFSNNYKDVIPFLEGFCGFIAGATAKGLTFPLDT LRKRIQMLSKTRDIDQNSIKAIQLCKTILKNEGIFGFYKGFSISILKSAPTSAISLFTYE YSLSAIKEFTSKHKKL
Uniprot No.

Target Background

Function

Mitochondrial transporter mediating the uptake of thiamine pyrophosphate (ThPP) into mitochondria.

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)?

Debaryomyces hansenii Mitochondrial thiamine pyrophosphate carrier 1 (TPC1) is a specialized transport protein belonging to the mitochondrial carrier family. This protein is encoded by the TPC1 gene (locus name: DEHA2E10428g) in Debaryomyces hansenii, a salt-tolerant yeast species. The protein consists of 316 amino acid residues and functions primarily in the inner mitochondrial membrane where it facilitates the transport of thiamine pyrophosphate and related compounds . Mitochondrial carriers like TPC1 are essential components of cellular metabolism as they shuttle various metabolites, nucleotides, and cofactors across the inner mitochondrial membrane, thereby connecting cytosolic and mitochondrial biochemical pathways . The full-length TPC1 protein has been successfully expressed as a recombinant protein and is available for research applications, enabling detailed investigations into its structure, function, and biochemical properties .

How should recombinant D. hansenii TPC1 be stored and handled for optimal stability?

Proper storage and handling of recombinant Debaryomyces hansenii TPC1 is crucial for maintaining its structural integrity and functional activity. According to established protocols, the recombinant protein should be stored at -20°C for regular use, while extended storage requires conservation at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein to enhance stability .

To maintain functional integrity, researchers should avoid repeated freezing and thawing cycles, as these can lead to protein denaturation and loss of activity. Instead, it is recommended to prepare working aliquots that can be stored at 4°C for up to one week . When handling the protein, gentle thawing on ice is preferable to rapid temperature changes. The following table summarizes the optimal storage conditions:

Storage PurposeTemperatureMaximum DurationNotes
Regular storage-20°CSeveral monthsIn original buffer with 50% glycerol
Extended storage-80°CYearsMinimize freeze-thaw cycles
Working aliquots4°CUp to one weekPrepare small volumes as needed

For experimental applications, researchers should consider the buffer composition when designing assays, as the presence of glycerol and Tris may influence certain biochemical reactions or interaction studies.

What is the functional role of TPC1 in Debaryomyces hansenii metabolism?

The primary function of TPC1 in Debaryomyces hansenii is to transport thiamine pyrophosphate (TPP) across the inner mitochondrial membrane. Based on studies with homologous proteins in other organisms, TPC1 imports thiamine pyrophosphate into mitochondria by exchange with intramitochondrial ATP and/or ADP . This transport mechanism is essential for maintaining proper mitochondrial metabolism, as TPP serves as a critical cofactor for several key mitochondrial enzymes, including pyruvate dehydrogenase and α-ketoglutarate dehydrogenase complexes.

What methodologies are most effective for functional characterization of D. hansenii TPC1?

Functional characterization of Debaryomyces hansenii TPC1 requires a multi-faceted approach combining molecular biology, biochemistry, and biophysical techniques. Based on successful studies with similar carriers, the following methodological pipeline has proven effective:

  • Heterologous Expression Systems: Over-expression of TPC1 in bacterial systems, particularly Escherichia coli, allows for the production of sufficient quantities of protein for functional studies . The recombinant protein can be tagged for easier purification while ensuring the tag does not interfere with function.

  • Protein Purification and Reconstitution: After expression, TPC1 should be purified using affinity chromatography followed by reconstitution into liposomes to mimic the native membrane environment . The reconstitution process typically involves:

    • Solubilization of the purified protein in appropriate detergents

    • Mixing with phospholipids at specific protein-to-lipid ratios

    • Detergent removal via dialysis or adsorption to Bio-Beads

    • Formation of proteoliposomes containing functional TPC1

  • Transport Assays: Liposome-based transport assays provide direct measurement of TPC1 activity. These involve:

    • Loading liposomes with specific substrates (e.g., ADP or ATP)

    • Initiating transport by adding external substrates (e.g., thiamine pyrophosphate)

    • Monitoring substrate exchange through radioactive tracers or fluorescent analogs

    • Determining kinetic parameters (Km, Vmax) for different substrates

  • Complementation Studies: Expression of D. hansenii TPC1 in Saccharomyces cerevisiae TPC1 null mutants can demonstrate functional conservation and rescue growth defects on fermentable carbon sources . This approach provides physiological context for the carrier's function.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues can identify critical amino acids involved in substrate binding and translocation, providing insights into the transport mechanism.

The combination of these methodologies allows for comprehensive characterization of TPC1's transport properties, substrate specificity, and kinetic parameters, establishing its role in D. hansenii metabolism.

How does D. hansenii TPC1 compare with thiamine pyrophosphate carriers in other species?

Comparative analysis of thiamine pyrophosphate carriers across species reveals important evolutionary and functional relationships. Debaryomyces hansenii TPC1 shares significant homology with carriers from other organisms while maintaining species-specific adaptations. When comparing D. hansenii TPC1 with its counterparts in other species, several notable similarities and differences emerge:

Drosophila melanogaster TPC1 (DmTpc1p) shows functional homology with D. hansenii TPC1, as both transport thiamine pyrophosphate as their primary substrate and can also transport pyrophosphate, ADP, ATP, and other nucleotides . This suggests a conserved core function across evolutionarily distant species. The main function of both carriers is to import thiamine pyrophosphate into mitochondria through exchange with intramitochondrial ATP and/or ADP .

In Saccharomyces cerevisiae, TPC1 deletion results in growth defects when grown on fermentable carbon sources, highlighting its metabolic importance . Interestingly, D. hansenii TPC1 can complement this deficiency when expressed in S. cerevisiae TPC1 null mutants, demonstrating functional conservation despite sequence differences . This cross-species complementation suggests that the fundamental transport mechanism and substrate specificity are preserved.

Human thiamine pyrophosphate carriers also maintain the core function but may exhibit different regulatory mechanisms and tissue-specific expression patterns. The conservation of TPC1 function across such diverse species underscores the evolutionary importance of thiamine metabolism and mitochondrial transport systems in eukaryotic cells.

What are the implications of TPC1 research for understanding yeast adaptation to extreme environments?

Debaryomyces hansenii is renowned for its exceptional adaptability to high-salt environments, making it an excellent model organism for studying extremophile adaptation. Research on TPC1 offers valuable insights into how metabolic transport systems contribute to this adaptive capability.

The transport of thiamine pyrophosphate into mitochondria is particularly significant in stress conditions, as it ensures the continued function of key metabolic enzymes during salt stress. Efficient thiamine pyrophosphate transport by TPC1 may enable D. hansenii to maintain energy production pathways even under challenging osmotic conditions. The role of TPC1 in D. hansenii's stress response is supported by studies showing that native strains of D. hansenii isolated from Danish brines possess antagonistic effects against specific contaminating molds, suggesting metabolic adaptations that contribute to their ecological fitness .

Comparative analyses of TPC1 sequences and transport kinetics between D. hansenii and non-halotolerant yeasts might reveal adaptations in the carrier protein that enhance its function in high-salt environments. Potential adaptations could include:

  • Modified substrate binding properties

  • Altered transport kinetics optimized for high-salt environments

  • Enhanced protein stability under osmotic stress

  • Regulatory mechanisms that respond to osmotic changes

Understanding these adaptations could provide broader insights into how mitochondrial transport systems evolve to support survival in extreme environments. This knowledge may also have applications in biotechnology, particularly in developing stress-resistant yeast strains for industrial processes.

How can recombinant TPC1 be used in transport assays to determine substrate specificity and kinetics?

Transport assays using recombinant TPC1 are essential for determining its substrate specificity and kinetic parameters. The following detailed methodology provides a framework for conducting these experiments:

  • Liposome Preparation with Reconstituted TPC1:

    • Purified recombinant TPC1 should be reconstituted into liposomes composed of a mixture of phospholipids (typically phosphatidylcholine and phosphatidic acid at a ratio of 9:1)

    • The protein-to-lipid ratio should be carefully controlled (approximately 1:100) to ensure optimal activity

    • Internal substrate loading is achieved during liposome formation by including the desired compound (e.g., ATP or ADP) in the reconstitution buffer

    • External substrate is removed by gel filtration chromatography

  • Homoexchange and Heteroexchange Measurements:

    • Homoexchange: Measuring the exchange of the same substrate (e.g., ATP for ATP)

    • Heteroexchange: Measuring the exchange of different substrates (e.g., thiamine pyrophosphate for ATP)

    • Both approaches utilize radiolabeled substrates to track transport across the liposomal membrane

  • Kinetic Parameter Determination:

    • Initial transport rates are measured at varying substrate concentrations

    • Michaelis-Menten kinetics are applied to determine Km and Vmax values

    • Inhibition studies can be performed by adding potential inhibitors to the external medium

    • Temperature dependence studies provide insights into the energetics of transport

A typical experimental setup involves:

ParameterMeasurement ConditionExpected Range for TPC1
Km for thiamine pyrophosphatepH 7.0, 25°C20-50 μM (estimated)
Km for ATPpH 7.0, 25°C150-300 μM (estimated)
VmaxOptimal conditionsSpecies-dependent
Temperature optimumpH 7.025-30°C
pH optimum25°C6.8-7.4

The relative transport rates for different substrates can be determined, establishing a preference hierarchy. Based on studies with similar carriers, the expected preference order would be: thiamine pyrophosphate > pyrophosphate > ATP/ADP > other nucleotides .

How does TPC1 differ from Two-Pore Channels with the same abbreviation?

It is critical for researchers to distinguish between two entirely different protein families that share the TPC1 abbreviation: Mitochondrial thiamine pyrophosphate carrier 1 and Two-Pore Channel 1. These proteins differ fundamentally in structure, function, cellular localization, and evolutionary origin.

Mitochondrial Thiamine Pyrophosphate Carrier 1 (TPC1):

  • Functions primarily as a transport protein in the inner mitochondrial membrane

  • Belongs to the mitochondrial carrier family (MCF) of proteins

  • Primarily transports thiamine pyrophosphate into mitochondria through exchange with ATP/ADP

  • Present in various organisms including Debaryomyces hansenii and other yeasts

  • Central to thiamine metabolism and energy production pathways

Two-Pore Channel 1 (TPC1):

  • Functions as an ion channel within membranes of intracellular acidic compartments such as endosomes and lysosomes

  • Belongs to the voltage-gated ion channel superfamily

  • Primarily mediates calcium currents responsible for fusion/fission events of endolysosomal membranes

  • Present in mammalian cells and involved in endocytosis, recycling, and degradation of surface receptors

  • Implicated in allergic and anaphylactic reactions in mammals

The key differences can be summarized in the following comparison table:

CharacteristicMitochondrial TPC1Two-Pore Channel TPC1
Cellular locationInner mitochondrial membraneEndosomal/lysosomal membranes
Primary functionMetabolite transportIon channel activity
Main substrateThiamine pyrophosphateCalcium ions
FamilyMitochondrial carrier familyVoltage-gated ion channel family
Typical experimental systemYeastMammalian cells
Research relevanceMetabolism, energy productionVesicle trafficking, immune responses

This distinction is particularly important when searching literature and designing experiments, as methodologies appropriate for one protein may be inadequate for studying the other .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.