Recombinant Debaryomyces hansenii NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MCR1; DEHA2E08228g; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
MCR1
Target Protein Sequence
MSFTRQLTKNLTSFKVLAPFAAAVGSVGIAYQYSTSSIMNETGKTFTGNDEWIDLKLAKS WDTTHNTKHFVFELANQDDVSGLINASCLLTKFVTPKGNNVIRPYTPISDVDGKGSIEFV IKKYDGGKMSSHIHDLKPNDTLAFKGPVVKWKWEPNQYKSIALIGGGTGITPLYQLMHEI TKNPEDKTKVNLFYGNLTEKDILIKKELDTIAEKHKDQVNVVYFLDKAPENWNGETGYIS KEFLQSKLPGPGKDNKVFVCGPPGLYKALSGPKKSPTDQGEVEGALADLGYTKENVFKF
Uniprot No.

Target Background

Function
May mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the biological function of NADH-cytochrome b5 reductase 2 (MCR1) in Debaryomyces hansenii?

    MCR1 in D. hansenii functions as an NADH-dependent oxidoreductase involved in electron transport pathways. Similar to its homologs in other yeasts, it primarily catalyzes the reduction of ferricyanide and other electron acceptors using NADH as an electron donor . The enzyme shows strong preference for NADH over NADPH, which is characteristic of this family of reductases .

    In mitochondria of other yeasts like S. cerevisiae, MCR1 exists in two forms - one anchored to the outer membrane and another inserted into the intermembrane space after cleavage of the N-terminal membrane-bound domain . This dual localization suggests MCR1 may serve distinct functions in different mitochondrial compartments, although the precise roles in D. hansenii require further investigation.

  • How does the primary structure of D. hansenii MCR1 compare to homologs from other organisms?

    D. hansenii MCR1 consists of 299 amino acid residues and shares significant sequence homology with other fungal NADH-cytochrome b5 reductases. Sequence alignment analysis reveals:

    OrganismSequence IdentityNotable Structural Features
    Lodderomyces elongisporus~70%Conserved FAD-binding domain and NADH-binding motifs
    Saccharomyces cerevisiae~60%N-terminal membrane-anchoring domain
    Neosartorya fumigata~45%Conserved catalytic residues
    Mortierella alpina~40%Flavin-binding β-barrel domain

    The protein contains highly conserved motifs characteristic of the flavoprotein family, particularly in regions involved in flavin and NADH binding. The flavin-binding domain features a specific arrangement of three highly conserved amino acid residues (arginine, tyrosine, and serine) that form hydrogen bonds with the flavin prosthetic group .

  • What are the recommended methods for cloning the MCR1 gene from D. hansenii?

    Based on established protocols for similar genes, the following approach is recommended:

    1. Design primers based on the D. hansenii MCR1 gene sequence (GenBank accession or genome database).

    2. For efficient cloning, incorporate restriction sites compatible with your expression vector (common sites include HindIII, BamHI, and XbaI) .

    3. Optimize the Kozak sequence around the start codon (CCACCATG) to enhance translation efficiency .

    4. Use high-fidelity PCR with genomic DNA from D. hansenii as template.

    5. Clone the PCR product into an intermediate vector (like pCR2.1) for sequence verification .

    6. Subclone into the final expression vector using appropriate restriction enzymes.

    The PCR conditions should be optimized for D. hansenii genomic DNA, which has a high GC content. Including DMSO (5-10%) in the reaction mix can help overcome secondary structures .

  • What heterologous expression systems work best for producing recombinant D. hansenii MCR1?

    Based on research with similar proteins, the following expression systems have proven effective:

    1. E. coli expression system: Most commonly used for MCR1 homologs due to high yield and ease of purification. BL21(DE3) strain with pET vectors containing an N-terminal His-tag has been successfully employed for MCR1 proteins from Lodderomyces elongisporus and Neosartorya fumigata .

    2. Filamentous fungi: Aspergillus oryzae has been used successfully for expressing the MCR1 homolog from Mortierella alpina .

    3. Yeast expression systems: For native-like post-translational modifications, S. cerevisiae or Pichia pastoris can be used, though expression levels may be lower than in E. coli .

    Critical factors for successful expression include proper codon optimization, optimal induction conditions (temperature, inducer concentration), and selection of appropriate fusion tags for solubility and purification .

  • What methods are available for assessing the purity and activity of recombinant D. hansenii MCR1?

    Purity assessment:

    • SDS-PAGE analysis (>90% purity is typically achievable)

    • Western blotting using anti-His antibodies for tagged proteins

    • Size-exclusion chromatography for analyzing oligomeric state

    Activity assays:

    • NADH-dependent ferricyanide reduction: The most common assay measures the decrease in absorbance at 420 nm, with an extinction coefficient of 1.02 mM⁻¹ cm⁻¹

    • NADH-DCPIP (2,6-dichlorophenol-indophenol) reduction: Monitors decrease in absorbance at 600 nm (extinction coefficient: 21.0 mM⁻¹ cm⁻¹)

    Assay conditions:

    • Buffer: 0.1 M potassium phosphate (pH 7.5)

    • NADH concentration: 10⁻³ M

    • Ferricyanide concentration: 10⁻³ M

    • Reaction volume: 1 mL

    • One unit of activity is defined as the amount causing reduction of 1 μmol of ferricyanide per minute

Advanced Research Questions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.