Recombinant Debaryomyces hansenii NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
ND3
Target Protein Sequence
MFTIYTYLAPIVAMVLVVLNYLISNNNSYIEKDGPFECGFTSYQQTRSAFSVAFILVAIL FLPFDLEMSSILPYVVSAYSNGTYGLSILVIFLLSLVIAFVYEINLGALNLERRYTPIVK PLMNKLYL
Uniprot No.

Target Background

Function

Recombinant Debaryomyces hansenii NADH-ubiquinone oxidoreductase chain 3 (ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Database Links

KEGG: dha:ND3

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Debaryomyces hansenii ND3?

Debaryomyces hansenii NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrial protein that functions as a component of Complex I in the electron transport chain. The protein consists of 128 amino acids and is encoded by the ND3 gene (also known as NAD3) . The primary function of this protein is to participate in the first step of the mitochondrial respiratory chain, catalyzing the transfer of electrons from NADH to ubiquinone (Coenzyme Q), coupled with proton translocation across the inner mitochondrial membrane.

The protein has an EC number of 1.6.5.3, classifying it as an oxidoreductase acting on NADH or NADPH with a quinone or similar compound as acceptor . The primary sequence contains multiple transmembrane regions, consistent with its role as a membrane-embedded component of the respiratory complex.

How does D. hansenii ND3 differ from homologous proteins in other species?

The ND3 protein from D. hansenii shows specific adaptations that may contribute to this yeast's remarkable halotolerance and stress resistance. While the core functional domains remain conserved across species, D. hansenii ND3 exhibits unique sequence variations that potentially allow the respiratory chain to function efficiently under high salt conditions or in the presence of various stress factors.

D. hansenii is taxonomically distinct from other yeasts, having been reclassified based on polyphasic analysis into three separate species: D. hansenii, D. fabryi, and D. subglobosus . These distinctions extend to the molecular level, where proteins like ND3 may exhibit specialized characteristics aligned with their ecological niches. The specific strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968 (also known as Torulaspora hansenii) has been the source of the recombinant ND3 protein in research applications .

What are the optimal storage conditions for recombinant D. hansenii ND3?

Recombinant D. hansenii ND3 requires specific storage conditions to maintain stability and activity. The recommended storage is at -20°C for routine use, while extended storage should be at -20°C or preferably -80°C . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain protein stability.

For working applications, aliquots should be stored at 4°C for no more than one week to minimize activity loss. Repeated freezing and thawing cycles should be strictly avoided as they can lead to protein denaturation and loss of activity . When planning experiments, researchers should prepare appropriately sized aliquots to avoid multiple freeze-thaw cycles.

What expression systems are most effective for producing recombinant D. hansenii ND3?

For heterologous expression of D. hansenii ND3, several systems have proven effective, with the choice depending on research objectives:

  • Homologous expression in D. hansenii: This approach leverages recently developed genetic tools for D. hansenii, including CRISPR-Cas9 systems that facilitate targeted gene manipulation . The TEF1 promoter from Arxula adeninivorans has shown high expression efficiency in D. hansenii .

  • Expression in conventional yeast systems: When using Saccharomyces cerevisiae or Pichia pastoris, codon optimization may be necessary to align with these hosts' codon usage preferences.

  • Bacterial expression systems: E. coli-based expression can be effective for structural studies but may require refolding protocols to obtain properly folded and active protein.

The expression strategy should be selected based on downstream applications, with homologous expression in D. hansenii being particularly valuable when studying native protein interactions or when post-translational modifications are critical.

How can in vivo DNA assembly techniques be applied to modify ND3 expression in D. hansenii?

Recent advances have demonstrated the feasibility of performing in vivo DNA assembly directly in D. hansenii, offering a streamlined approach for genetic manipulation. This technique allows for the assembly of up to three different DNA fragments with 30-bp homologous overlapping overhangs co-transformed into the yeast, which are then fused in the correct order in a single step .

For ND3 modification, this method can be applied using the following protocol:

  • Design DNA fragments with 30-bp overlapping regions flanking the ND3 gene or regulatory elements

  • Co-transform these fragments into D. hansenii along with a suitable selection marker

  • Allow the yeast's homologous recombination machinery to assemble the fragments in vivo

  • Screen transformants for successful assembly and expression

This approach is particularly valuable for high-throughput screening of different promoters, terminators, and signal peptides to enhance ND3 expression. Research has shown that using the TEF1 promoter from Arxula adeninivorans yields high expression levels in D. hansenii when cultured in salt-rich media .

What analytical techniques are most appropriate for characterizing D. hansenii ND3 activity?

Analytical MethodApplicationAdvantagesLimitations
Spectrophotometric assaysNADH oxidation activity measurementRapid, quantitativePotential interference from other cellular components
Oxygen consumption assaysRespiratory chain functionDirect measure of electron transportRequires specialized equipment (oxygen electrode)
Blue native PAGEComplex I assembly analysisPreserves native protein complexesLimited quantitative capability
ImmunoblottingProtein expression and localizationHigh specificityRequires specific antibodies
Mass spectrometryProtein identification and post-translational modificationsHigh resolution and sensitivityExpensive equipment, complex data analysis

When measuring ND3 activity as part of Complex I, researchers should monitor NADH oxidation coupled to ubiquinone reduction. This can be achieved spectrophotometrically by following the decrease in NADH absorbance at 340 nm in the presence of ubiquinone or ubiquinone analogs. For in vivo studies, oxygen consumption measurements using a Clark-type electrode can provide insights into the functional integration of ND3 within the respiratory chain.

What makes D. hansenii valuable as a biotechnological research organism?

D. hansenii possesses several distinctive characteristics that make it exceptionally valuable for biotechnological applications:

  • Halotolerance: D. hansenii can grow in environments with high salt concentrations, allowing for cultivations in non-sterile conditions where salt acts as a natural selective agent .

  • Stress resistance: The yeast demonstrates remarkable tolerance to fermentation inhibitors such as furfural, vanillin, and organic acids, making it suitable for industrial processes using complex or impure feedstocks .

  • By-product utilization: D. hansenii can grow on and revalorize various industrial by-products, particularly those rich in salt from the dairy and pharmaceutical industries, without requiring nutritional supplements or freshwater .

  • Recombinant protein production: The yeast has been successfully engineered to produce recombinant proteins such as Yellow Fluorescent Protein (YFP) when grown on industrial by-products, demonstrating its potential for sustainable bioprocessing .

  • Antimicrobial properties: D. hansenii can produce killer toxins (mycocins) that are effective against pathogenic yeasts including Candida albicans and C. tropicalis, suggesting applications in biocontrol or therapeutic development .

These characteristics position D. hansenii as an excellent candidate for developing sustainable bioprocesses that utilize industrial waste streams while minimizing water consumption and contamination risks.

How has the taxonomy of D. hansenii evolved, and what implications does this have for research?

The taxonomy of D. hansenii has undergone significant revisions based on polyphasic analysis combining molecular, physiological, and morphological characteristics. Originally considered a single heterogeneous species, D. hansenii has been reclassified into three distinct species:

  • Debaryomyces hansenii (represented by type strain CBS 767T = MUCL 49680T)

  • Debaryomyces fabryi (represented by type strain CBS 789T = MUCL 49731T)

  • Debaryomyces subglobosus (represented by type strain CBS 792T = MUCL 49732T)

This taxonomic revision has important implications for research:

  • Researchers must verify which specific strain they are working with to ensure accurate comparisons with literature data

  • Previously reported characteristics may need to be re-evaluated in light of the refined taxonomy

  • Functional differences between these species, including variations in stress tolerance and metabolic capabilities, may explain previously inconsistent experimental results

The distinction between these species was established through DNA reassociation studies, phylogenetic analyses, and growth characteristics at different temperatures (35°C and 37°C) . The type strain most commonly used for recombinant ND3 production is D. hansenii ATCC 36239 / CBS 767 , which corresponds to the reinstated D. hansenii sensu stricto.

How might D. hansenii ND3 contribute to understanding respiratory adaptation in extreme environments?

D. hansenii's remarkable ability to thrive in high-salt environments and under various stress conditions makes its respiratory components, including ND3, excellent models for studying respiratory chain adaptations to extreme conditions. Several research approaches can elucidate these adaptations:

  • Comparative structural analysis: Analyzing structural differences between D. hansenii ND3 and homologs from non-halotolerant yeasts can reveal adaptations that maintain function under osmotic stress.

  • Site-directed mutagenesis: Systematic mutation of unique residues in D. hansenii ND3 can identify those critical for function under high salt conditions.

  • Heterologous expression: Expressing D. hansenii ND3 in salt-sensitive organisms and measuring phenotypic changes can reveal its contribution to salt tolerance.

  • Respiratory flux analysis: Measuring electron transport rates under various salt concentrations can quantify how D. hansenii maintains energy production under stress conditions.

Understanding these adaptations could inform the development of stress-resistant industrial microorganisms and provide insights into fundamental mechanisms of protein stabilization under extreme conditions.

What role might ND3 play in D. hansenii's antimicrobial properties?

D. hansenii produces killer toxins (mycocins) that are effective against pathogenic yeasts like Candida albicans and C. tropicalis . While ND3 is not directly involved in toxin production, its role in energy metabolism may indirectly influence this process:

  • The killer toxin production likely requires substantial energy input, particularly during secretion processes.

  • As a component of Complex I in the electron transport chain, ND3 contributes to ATP generation through oxidative phosphorylation.

  • Modulation of ND3 activity could potentially affect the energy available for toxin synthesis and secretion.

Research methodologies to investigate this relationship could include:

  • Creating ND3 mutants with altered activity and measuring their killer toxin production

  • Analyzing the correlation between respiratory capacity and killer toxin yield

  • Investigating energy requirements during different phases of toxin production and secretion

This research direction could yield insights into both basic biology and potential applications in developing biocontrol agents or novel antifungal approaches.

What emerging technologies could advance D. hansenii ND3 research?

Several cutting-edge technologies show promise for advancing research on D. hansenii ND3:

Implementation of these technologies would require interdisciplinary collaboration but could significantly advance our understanding of how D. hansenii adapts its respiratory chain to challenging environments.

How can systems biology approaches enhance our understanding of ND3's role in D. hansenii metabolism?

Systems biology approaches can provide a comprehensive view of ND3's role within D. hansenii's broader metabolic network:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data can reveal how ND3 expression correlates with other cellular components under various conditions.

  • Genome-scale metabolic modeling: Including ND3 function in constraint-based metabolic models can predict its systemic impact on cell physiology.

  • Protein-protein interaction networks: Identifying ND3 interaction partners can reveal unexpected functional relationships.

  • Flux balance analysis: Mathematical modeling of metabolic fluxes can quantify how alterations in ND3 function propagate through metabolic pathways.

Despite the sequencing of D. hansenii's genome in 2004 and recent development of molecular tools, fundamental knowledge gaps persist regarding its metabolism and regulatory networks . Systems biology approaches offer promising avenues to address these gaps and fully characterize the role of ND3 in D. hansenii's remarkable stress adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.