Recombinant Debaryomyces hansenii NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Debaryomyces hansenii NADH-Ubiquinone Oxidoreductase Chain 6 (ND6)

Recombinant Debaryomyces hansenii NADH-ubiquinone oxidoreductase chain 6 (ND6) is a mitochondrial protein subunit critical for respiratory Complex I, the largest enzyme in the electron transport chain. This recombinant form is expressed in E. coli with an N-terminal His-tag for purification and structural studies. It spans the full-length sequence (1–146 amino acids) of the native ND6 protein, encoded by the mitochondrial ND6 gene in D. hansenii .

Biological Role in Mitochondrial Respiration

ND6 is a core subunit of Complex I, which oxidizes NADH to ubiquinone while translocating protons across the inner mitochondrial membrane. In D. hansenii, Complex I is part of a conserved respiratory machinery critical for ATP synthesis . Key findings include:

  • Mitochondrial Localization: ND6 is encoded in the mitochondrial genome of D. hansenii, as confirmed by genomic analyses .

  • Evolutionary Conservation: The ND6 gene is present in diverse yeasts, including Candida parapsilosis and Pichia guilliermondii, underscoring its universal role in fungal respiration .

  • Proton-Pumping Activity: Complex I in fungi like Ophiocordyceps parapolymorpha exhibits condition-dependent flux redistribution between proton-translocating (e.g., Complex I) and non-translocating (alternative NADH dehydrogenases) pathways, affecting metabolic efficiency .

Experimental Uses

ApplicationDescription
SDS-PAGE AnalysisUsed to verify protein purity and size (predicted ~16.5 kDa)
Protein Interaction StudiesHis-tag enables affinity chromatography for studying Complex I assembly
Metabolic Flux AnalysisPotential use in modeling NADH/ubiquinone dynamics in fungal respiration

Challenges and Considerations

  • Expression Limitations: Native Complex I assembly requires accessory subunits and chaperones, which are absent in E. coli. Recombinant ND6 may lack functional activity without co-expressed partners .

  • Stability: Repeated freeze-thaw cycles degrade activity. Aliquoting and storage at -20°C/-80°C are essential .

Genomic and Proteomic Insights

  • Mitochondrial Gene Organization: The ND6 gene in D. hansenii is part of a linear mitochondrial genome, unlike circular genomes in other fungi. This structure influences replication and transcription .

  • Protein Network: STRING DB analysis reveals ND6 interactions with other Complex I subunits (e.g., ND1, ND2, ND3), forming a functional core .

Research Gaps and Future Directions

  1. Functional Characterization: No studies directly link recombinant ND6 to enzymatic activity or proton pumping in D. hansenii.

  2. Biotechnological Applications: Potential use in engineered strains for biofuel production or stress tolerance, leveraging D. hansenii's halotolerance and lipid metabolism .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. As a default, we include a 50% final concentration of glycerol. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ND6; NAD6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
ND6
Target Protein Sequence
MNTISGMSSLTAIGMLTPVQSMTCLMILFVSTAMCLYSQGFVLMGMLYVTMYVGAMAMLF LFMLSLLKMEYTPQGTITPLMVTLLAMCLMPLDITYETYGMVTQMENVTDELVMVGNQLY TEYAMLLMLTGMMLMLSVMGAMSITK
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly necessary for enzymatic activity. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Database Links

KEGG: dha:ND6

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the role of ND6 in Debaryomyces hansenii's respiratory chain?

ND6 functions as an essential component of Complex I (NADH-ubiquinone oxidoreductase) in the mitochondrial respiratory chain of D. hansenii. The respiratory chain in this halotolerant yeast contains the classical complexes I, II, III, and IV, plus alternative pathways including a cyanide-insensitive, AMP-activated, alternative oxidase (AOX) . ND6 is integrated early into what's known as the ND2 module during Complex I assembly. When investigating the relative composition of Complex I, researchers have observed that deficiency of wild-type ND6 can cause a stalemate in the formation of this module, significantly affecting the stability and activity of the entire Complex I .

How does D. hansenii's respiratory chain differ from conventional yeast systems?

D. hansenii exhibits a more complex branched respiratory chain compared to conventional yeasts like Saccharomyces cerevisiae. This system includes not only the classical respiratory complexes (I-IV) but also contains two additional alternative oxidoreductases: an alternative NADH dehydrogenase (NDH2e) and a mitochondrial isoform of glycerol-phosphate dehydrogenase (MitGPDH) . These monomeric enzymes lack proton pump activity and are located on the outer face of the inner mitochondrial membrane. Notably, NDH2e oxidizes exogenous NADH in a rotenone-insensitive, flavone-sensitive process . Furthermore, D. hansenii possesses respiratory supercomplexes containing complexes I, III, and IV in different stoichiometries, which have been estimated to include configurations such as IV₂, I-IV, III₂-IV₄, V₂, I-III₂, I-III₂-IV, I-III₂-IV₂, I-III₂-IV₃, and I-III₂-IV₄ .

What are the key methodological approaches for studying ND6 function in D. hansenii?

When investigating ND6 function in D. hansenii, researchers typically employ a combination of genetic, biochemical, and computational approaches:

  • Genetic manipulation: PCR-based methods for gene disruption based on homologous recombination, using long flanking regions (500 bp to 1 kb) cloned into vectors like pHygR, pKanR, or pSAT1 . For specific gene deletions or modifications, 50 bp flanking regions can be introduced by PCR using primers that anneal on selectable cassettes with extensions identical to the flanking regions of target ORFs .

  • Protein localization and characterization: Fluorescent tagging using GFP in chromosomal context, with constitutive heterologous promoters like MgACT1 .

  • Complex I activity assessment: In-gel activity assays using NADH and nitrotetrazolium blue chloride to visualize active Complex I, followed by densitometric analysis .

  • Structural analysis: Molecular dynamics simulations to analyze protein stability, conformation, and interactions within the respiratory complex .

  • Complex assembly analysis: Blue Native PAGE and 2D Blue Native/SDS-PAGE to explore the levels of subunits integrated into Complex I .

How can researchers effectively generate recombinant ND6 constructs in D. hansenii?

To generate recombinant ND6 constructs in D. hansenii, follow this methodological approach:

  • Design appropriate flanking regions: For optimal homologous recombination efficiency, use long flanking regions between 500 bp and 1 kb in length, cloned into appropriate selection vectors (pHygR, pKanR, or pSAT1) .

  • PCR amplification strategy: When targeting the ND6 gene, design primers that anneal to the selectable marker cassette and contain 50 nt 5′ extensions identical to the flanking regions of the ND6 ORF. For higher efficiency, consider extending the homology arms to 90-100 bp, as longer flanks provide higher efficiency of targeted integration and expression .

  • Transformation protocol: Use electroporation for transformation of PCR products, following established protocols with adaptations specific to D. hansenii .

  • Screening and validation: Screen potential gene modification mutants for the presence of the intended modification and for the absence of the wild-type copy before proceeding to functional analysis. This typically involves PCR verification and sequence confirmation .

  • Expression validation: For tagged constructs, confirm proper expression and localization using methods like fluorescence microscopy (for GFP-tagged constructs) or western blotting .

What are the optimal conditions for isolating functional mitochondria to study ND6 in Complex I?

For isolating functional mitochondria to study ND6 in Complex I from D. hansenii, adapt this protocol:

  • Cell lysis optimization: Due to D. hansenii's robust cell wall, optimize mechanical disruption methods (like glass bead homogenization) with appropriate buffers containing osmotic stabilizers to maintain mitochondrial integrity.

  • Differential centrifugation: Employ a series of centrifugation steps to separate mitochondria from other cellular components. Typically, an initial low-speed centrifugation (1,000-2,000g) removes cell debris, followed by a medium-speed centrifugation (10,000-12,000g) to collect the mitochondrial fraction .

  • Density gradient purification: For higher purity, use sucrose or Percoll density gradient centrifugation to separate mitochondria from other organelles.

  • Functional integrity assessment: Verify the integrity of isolated mitochondria by measuring oxygen consumption rates, membrane potential, or specific enzyme activities like Complex I activity using NADH oxidation assays .

  • Storage conditions: Store isolated mitochondria at -80°C in an appropriate buffer containing protease inhibitors to preserve Complex I integrity for subsequent analyses .

How can molecular dynamics simulations inform our understanding of ND6 structure and function?

Molecular dynamics simulations provide valuable insights into ND6 structure and function through several key analyses:

  • Residual Mean Square Fluctuation (RMSF) analysis: This measures the movement of specific protein regions during simulation. For example, simulations of truncated ND6 (ΔND6) show elevated movement in the N-terminal region compared to wild-type ND6, suggesting spatial rearrangement or partial unfolding when the C-terminus is lost .

  • Solvent Accessible Surface Area (SASA) analysis: This determines the protein surface exposed to solvent. SASA analysis of ΔND6 suggests adoption of a more compact conformation compared to wild-type ND6, with low fluctuations indicating conformational rearrangements rather than complete unfolding .

  • Native contact preservation assessment: By comparing native contacts (defined as Cα atoms less than 7 Å apart) between wild-type and mutant structures, researchers can quantify structural divergence. In the case of ΔND6, approximately one-quarter of original contacts are lost during simulation, but the retained fraction remains stable in later stages .

  • Stability prediction: Simulations can predict whether mutations lead to conformational rearrangements versus misfolding or unfolding events. For ΔND6, simulations suggest it undergoes conformational rearrangements rather than complete degradation, potentially enabling negative interactions with Complex I via its N-terminal region .

What controls should be included when studying ND6 mutations or modifications?

When studying ND6 mutations or modifications in D. hansenii, incorporate these essential controls:

  • Wild-type comparison: Always include wild-type D. hansenii strains as positive controls. When analyzing mutant phenotypes, compare samples from the same tissues or growth conditions between mutant and wild-type strains. For example, when studying mitochondrial function in tumoral tissues expressing ΔND6, researchers included mitochondria from both distal and tumor liver tissues of a patient not carrying the mutation (Pt_ND6-WT) .

  • Empty vector controls: For recombinant expression studies, include strains transformed with empty vectors to control for effects of the transformation process and selectable marker expression.

  • Protein loading controls: When performing gel electrophoresis or western blotting, include loading controls to normalize protein levels. For respiratory chain components, consider using constitutively expressed mitochondrial proteins that aren't part of the complex being studied .

  • Functional controls: Include assays that verify the specificity of observed effects. For instance, when studying Complex I deficiency, confirm that other respiratory complexes (III, V) show no significant differences between samples .

  • Technical replicates: Perform densitometry analysis on multiple technical replicates to ensure statistical validity. Report results with appropriate error margins (e.g., "56% ± 6.5%" for Complex I reduction) .

How does ND6 contribute to the assembly and stability of Complex I in D. hansenii?

ND6 plays a critical role in the assembly and stability of Complex I in D. hansenii through several mechanisms:

  • Early integration in assembly process: ND6 is integrated into the ND2 module at an early stage of Complex I assembly. Deficiency of wild-type ND6 can cause a stalemate in the formation of this module, affecting subsequent assembly steps .

  • Structural stability contribution: Molecular analyses demonstrate that ND6 provides structural stability to Complex I. When ND6 is truncated (ΔND6), there is a significant reduction in Complex I stability (56% ± 6.5% reduction observed in experimental studies) .

  • Activity maintenance: Beyond structural contributions, ND6 is essential for maintaining Complex I activity. In-gel activity assays reveal that truncated ND6 leads to approximately 55% ± 14% decrease in Complex I activity compared to wild-type ND6 .

  • Module coordination: ND6 helps coordinate the integration of both nuclear-encoded and mitochondrially-encoded subunits. Experiments show that when ND6 is compromised, there is an imbalance between these two sets of proteins. Nuclear-encoded proteins decrease in abundance while mitochondrially-encoded proteins remain unchanged or increase, suggesting a regulatory feedback mechanism responding to ND6 status .

  • Protein quality control interaction: ND6 status influences the protein quality control pathways that regulate orphaned OXPHOS proteins. Proper ND6 function ensures balanced assembly of the complex, while defective ND6 triggers degradation of unincorporated nuclear-encoded subunits .

What are the implications of truncated ND6 (ΔND6) expression on respiratory chain function?

The expression of truncated ND6 (ΔND6) has profound implications for respiratory chain function:

  • Selective Complex I destabilization: ΔND6 expression leads to a significant reduction in Complex I levels (56% ± 6.5% reduction), while other respiratory complexes (Complex III and V) remain unaffected, confirming that ND6 truncation specifically impacts Complex I stability .

  • Activity impairment: Even when normalized to the amount of stable Complex I present, activity assays show a substantial decrease in Complex I function (55% ± 14% reduction) in mitochondria expressing ΔND6 .

  • Conformational changes: Molecular dynamics simulations reveal that ΔND6 undergoes significant conformational rearrangements rather than complete unfolding. The truncated protein adopts a more compact conformation and loses approximately one-quarter of its native contacts, while the N-terminal region shows elevated movement compared to wild-type ND6 .

  • Assembly disruption: Despite the presence of ΔND6, some full Complex I can still be assembled, but its composition is altered. 2D Blue Native/SDS-PAGE analysis shows lower presence of nuclear-encoded subunits belonging to the Q and P modules in Complex I containing ΔND6, indicating compromised stability of the fully assembled complex .

  • Compensatory mechanisms: In response to ΔND6 expression, mitochondria show altered regulation of other respiratory chain components. While nuclear-encoded subunits decrease, mitochondrially-encoded subunits are either unchanged (ND1) or significantly increased (ND2, ND5), suggesting a compensatory mechanism attempting to maintain respiratory function .

How can researchers distinguish between direct and indirect effects of ND6 manipulation on mitochondrial function?

To distinguish between direct and indirect effects of ND6 manipulation, researchers should implement these methodological approaches:

  • Time-course experiments: Monitor changes in mitochondrial function parameters at multiple time points following ND6 manipulation. Direct effects typically manifest earlier than secondary adaptations or compensatory responses.

  • Complementation studies: Introduce wild-type ND6 into ΔND6 models to determine which phenotypes can be rescued. Effects that are immediately reversed upon complementation are likely direct consequences of ND6 dysfunction .

  • Specific inhibitor controls: Use specific inhibitors of Complex I (e.g., rotenone) alongside ND6 manipulation to differentiate between general Complex I inhibition effects and ND6-specific mechanisms .

  • Component-specific analyses: Separately analyze individual aspects of mitochondrial function:

    • Electron transport chain activity using specific substrate combinations

    • Membrane potential using potentiometric dyes

    • ATP production rates

    • Reactive oxygen species generation

    • Mitochondrial morphology and dynamics

  • Combined proteomics and transcriptomics: Compare changes in protein levels (particularly of other respiratory complex subunits) with changes in corresponding gene expression. Discordant changes may indicate post-transcriptional regulation or compensatory mechanisms rather than direct effects of ND6 manipulation .

What techniques can detect protein-protein interactions involving ND6 in respiratory supercomplexes?

To detect protein-protein interactions involving ND6 in respiratory supercomplexes, employ these advanced techniques:

  • Blue Native PAGE (BN-PAGE): This non-denaturing electrophoretic technique preserves native protein complexes. Combined with western blotting using antibodies against ND6 or other Complex I components, it can reveal the integration of ND6 into supercomplexes. Based on existing studies, researchers have identified multiple supercomplex configurations in D. hansenii, including IV₂, I-IV, III₂-IV₄, V₂, I-III₂, I-III₂-IV, I-III₂-IV₂, I-III₂-IV₃, and I-III₂-IV₄ .

  • 2D Blue Native/SDS-PAGE: This two-dimensional approach separates intact complexes in the first dimension (BN-PAGE) and then their component proteins in the second dimension (SDS-PAGE). It provides detailed information about which proteins interact with ND6 in the context of respiratory supercomplexes .

  • Chemical crosslinking coupled with mass spectrometry (XL-MS): This technique uses crosslinking agents to covalently link interacting proteins, followed by mass spectrometry to identify the crosslinked peptides, providing information about interaction interfaces.

  • Co-immunoprecipitation (Co-IP): Using antibodies against ND6 or tagged versions of ND6, researchers can pull down interacting proteins from solubilized mitochondrial membranes, followed by identification via western blotting or mass spectrometry.

  • Proximity labeling: Techniques like BioID or APEX2, where ND6 is fused to a biotin ligase, can identify proteins in close proximity to ND6 in living cells, capturing both stable and transient interactions within the respiratory chain.

How does ND6 function in D. hansenii compare to its role in other organisms?

The function of ND6 in D. hansenii compared to other organisms reveals important evolutionary and functional insights:

What role might D. hansenii and its ND6 play in human disease contexts?

Recent research reveals several potential connections between D. hansenii, its respiratory components including ND6, and human disease:

  • Inflammatory bowel disease association: D. hansenii has been discovered in incompletely healed intestinal wounds of mice and inflamed mucosal tissues of Crohn's disease patients. The fungus preferentially localizes to these sites and can impair colonic healing when introduced into injured mice .

  • Mechanistic pathway in inflammation: D. hansenii impairs mucosal healing through the myeloid cell-specific type 1 interferon-CCL5 axis . Given that mitochondrial function (including Complex I activity) is critical for macrophage polarization and inflammatory responses, ND6 dysfunction could potentially modulate the fungus's pathogenicity.

  • Metabolic implications: As a component of Complex I, ND6 is central to cellular energy production. D. hansenii with altered ND6 function could influence host metabolism in colonized tissues, potentially contributing to the metabolic dysregulation observed in inflammatory conditions.

  • Parallel with cancer mechanisms: Studies show that ND6 mutations in mammals are associated with tumor development, with truncated ND6 (ΔND6) significantly reducing Complex I stability and activity . If similar mechanisms operate in fungal-host interactions, D. hansenii with altered ND6 could influence cellular transformation processes.

  • Therapeutic targeting potential: Understanding the role of D. hansenii's ND6 in human disease contexts could reveal novel therapeutic targets. If specific features of fungal ND6 differ from human counterparts, these differences could be exploited for selective antifungal approaches in conditions where D. hansenii contributes to pathology .

How can recombinant ND6 be used as a tool to study mitochondrial disorders?

Recombinant ND6 from D. hansenii offers several advantages as a research tool for studying mitochondrial disorders:

  • Model system for pathogenic mutations: By creating recombinant D. hansenii strains expressing ND6 variants that mimic human disease mutations, researchers can study their effects in a simplified system. The truncated ΔND6 model demonstrates how C-terminal truncation destabilizes Complex I, providing insights relevant to human mitochondrial disorders .

  • Complementation studies: Recombinant wild-type ND6 can be used to complement defective ND6 in experimental models, helping to establish causality between specific mutations and observed phenotypes. This approach can validate the pathogenicity of novel ND6 variants identified in patients with mitochondrial disorders.

  • Structure-function analysis: Creating a series of recombinant ND6 constructs with systematic mutations can map critical functional domains and residues. Molecular dynamics simulations of these variants can predict how specific alterations affect protein stability and Complex I assembly .

  • Drug screening platform: D. hansenii expressing recombinant ND6 variants can serve as a platform for screening compounds that might rescue defective Complex I function. This could accelerate the discovery of treatments for mitochondrial disorders caused by ND6 mutations.

  • Interspecies functional conservation: By testing whether human ND6 can functionally replace D. hansenii ND6, researchers can explore the degree of functional conservation across species and identify universal versus species-specific aspects of ND6 function, informing the translation of findings between model systems and human disease.

What are the key challenges and limitations in studying recombinant ND6 in D. hansenii?

Researchers face several significant challenges when studying recombinant ND6 in D. hansenii:

  • Genetic manipulation complexity: While methods have been developed for gene deletion and tagging in D. hansenii, they require specific adaptations not needed in conventional model yeasts. For optimal results, researchers need to use long flanking regions (500 bp to 1 kb) or extend homology arms to 90-100 bp for efficient targeted integration .

  • Mitochondrial genome editing limitations: As ND6 is encoded in the mitochondrial genome, conventional nuclear genome editing techniques are insufficient. Specialized approaches for mitochondrial transformation in D. hansenii remain limited, complicating direct manipulation of the native ND6 gene.

  • Phenotypic analysis challenges: Complex I activity assessment requires specialized techniques like in-gel activity assays using NADH and nitrotetrazolium blue chloride . These methods require careful standardization and may have limited sensitivity for detecting subtle functional changes.

  • Structural analysis constraints: While computational approaches like molecular dynamics simulations provide valuable insights into ND6 structure and function , they require validation through experimental methods. The lack of high-resolution structural data specific to D. hansenii complex I limits the accuracy of these simulations.

  • Translational relevance questions: While D. hansenii offers advantages as a model system, differences in respiratory chain organization compared to human mitochondria (such as the presence of additional alternative oxidoreductases ) raise questions about the translational relevance of findings to human mitochondrial disorders.

What emerging technologies could advance our understanding of ND6 function in D. hansenii?

Several cutting-edge technologies show promise for enhancing our understanding of ND6 function:

  • CRISPR-based mitochondrial genome editing: While still developing, CRISPR systems adapted for mitochondrial DNA editing could enable precise manipulation of the ND6 gene in its native context, overcoming current limitations in mitochondrial genome engineering.

  • Cryo-electron microscopy (Cryo-EM): Applied to purified D. hansenii respiratory complexes, cryo-EM could provide high-resolution structural information about ND6 within Complex I and respiratory supercomplexes, complementing the molecular dynamics simulation approach currently used .

  • Single-cell metabolomics: This emerging technology could reveal how variations in ND6 affect cellular metabolism at the individual cell level, capturing heterogeneity in responses that might be missed in bulk analyses.

  • Live-cell imaging of respiratory complex assembly: Fluorescent tagging approaches already developed for D. hansenii could be extended to monitor Complex I assembly in real-time, revealing the temporal dynamics of ND6 integration.

  • Multi-omics integration: Combining proteomics, transcriptomics, and metabolomics data from D. hansenii with varying ND6 status could provide a systems-level understanding of how this protein influences cellular function beyond its immediate role in Complex I.

How might bioengineered variants of ND6 be used to enhance D. hansenii's biotechnological applications?

Bioengineered ND6 variants could potentially enhance D. hansenii's biotechnological value through several mechanisms:

  • Enhanced stress tolerance: By optimizing ND6 function within the respiratory chain, engineered D. hansenii strains might show improved growth under industrial stress conditions (high salt, ethanol, or inhibitors). The halophilic nature of D. hansenii already makes it valuable for biotechnology, and optimized respiratory function could further enhance its resilience .

  • Improved lipid production: D. hansenii can accumulate lipids to over 50% of its biomass, making it promising for industrial lipid production . Since energy metabolism and redox balance (influenced by Complex I) are critical for lipid synthesis, engineered ND6 variants could potentially enhance lipid accumulation by optimizing NAD+/NADH ratios.

  • Controlled protein production: Manipulating ND6 and consequently respiratory function could help develop strains with controlled growth rates optimal for recombinant protein production. By fine-tuning energy metabolism, researchers might create expression systems with improved yields of target proteins.

  • Metabolic engineering applications: Understanding how ND6 variants affect electron flow through different branches of D. hansenii's respiratory chain could enable the design of strains with custom-tailored redox metabolism for specific biotechnological applications, such as bioremediation or production of high-value compounds.

  • Enhanced mitochondrial transfer: Given D. hansenii's presence in human tissues under certain conditions , engineered variants with optimized ND6 could potentially be developed as vehicles for delivering functional mitochondrial components to human cells with mitochondrial defects, though this would require extensive safety evaluation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.