Recombinant Debaryomyces hansenii Nuclear fusion protein KAR5 (KAR5)

Shipped with Ice Packs
In Stock

Description

Biotechnological Production

The protein is produced recombinantly in E. coli systems, leveraging the host’s high-yield expression capabilities. Critical production parameters include:

  • Expression Vector: Cloned into plasmids with N-terminal His-tags for affinity chromatography .

  • Purification: >90% purity via SDS-PAGE, followed by lyophilization in Tris/PBS buffer with 6% trehalose (pH 8.0) .

  • Storage: Stable at -20°C/-80°C; reconstitution in sterile water with 50% glycerol recommended .

Functional Role in Nuclear Fusion

KAR5 facilitates nuclear membrane fusion during yeast mating. Key mechanistic insights (derived from ortholog studies) include:

  • Localization: Concentrates near spindle pole bodies (SPBs) during pheromone induction, organizing fusogenic complexes at membrane contact sites .

  • Membrane Bridging: Mutants in KAR5 orthologs exhibit incomplete outer nuclear membrane fusion, resulting in thin (~48 nm diameter) membranous bridges .

  • Luminal Activity: As a lumenal ER protein, KAR5 likely stabilizes membrane curvature rather than acting as a direct fusogen .

Research Applications

Recombinant D. hansenii KAR5 is utilized in:

  • ELISA-Based Studies: Detecting protein-protein interactions during karyogamy .

  • Structural Biology: Analyzing conserved residues critical for membrane fusion .

  • Industrial Biotechnology: D. hansenii’s salt tolerance enables recombinant protein production in high-salinity waste substrates (e.g., dairy by-products) .

Comparative Analysis with Orthologs

SpeciesUniProt IDLength (aa)Expression HostKey Functional Divergence
D. hanseniiQ6BNJ4574E. coliHalotolerance; industrial applications
S. cerevisiaeQ04746485E. coliPheromone-induced SPB localization
C. albicansQ59WU8470E. coliPathogenicity-linked membrane dynamics

Challenges and Future Directions

  • Functional Studies: Most mechanistic data derive from S. cerevisiae; D. hansenii-specific roles require validation .

  • Optimization: Enhancing yield in non-sterile, saline industrial by-products using CRISPR-engineered strains .

  • Therapeutic Potential: Exploring homologs in fungal pathogens for antifungal drug targeting .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
KAR5; DEHA2E21208g; Nuclear fusion protein KAR5; Karyogamy protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-574
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
KAR5
Target Protein Sequence
TMHDGENNNVGKMLQEPTYLQSEMIESIMSRHLESFSLTESDFEDIIFMKPRSKCVKDAL KDIIPECMRLGVDSIEPGLQKKAAIQLSICEFENSKVTYPSSCYNMINDNDFDSCIFDIE RAPQYWTTFSGYYREITKICYEESLPFEKEQIISLYSNITKLYSKMFQDLNDSYKDSTHI QQMMKNEFKELQRMMKVILDQNEKTSEEVKEKYEEFSEQYSSMLSTSLEISKKFSLGTEN LVEDMANNIKYLDFELSRISIAIEDLDFETKLTDMKNSVLDDVRNLSDESISLLDSILTN LESLDILSQDAQNITNGISQSLKKNEVLSNNMNNALIETDTQLHEHNEVIRFEFEETISY LSQFSDQAIDNAIRDTSEEITKHVATFIDSINLRLEETTTKLEEVIYNIDDLSDKVGNAS SYLIEGLNLLTSNGIMDALLLTYNNVASGLESGFGMLTTLKSDIFKIVRFITACILFAIL FIWSMNRLFSQNRTKHTTLSSISPIGILNFRRIFRFLTNLALWLSVMGGTLLAVIVTNFL IQLKVYISKLSTND
Uniprot No.

Target Background

Function
This protein is essential for nuclear membrane fusion during karyogamy.
Database Links
Protein Families
KAR5 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii and why is it significant for KAR5 research?

Debaryomyces hansenii is a halotolerant, osmotolerant, and cryotolerant yeast commonly found in dairy products, particularly cheese. This microorganism can tolerate salinity levels up to 24%, making it exceptionally well-adapted to harsh environments . D. hansenii is particularly significant for protein expression studies due to its ability to grow in the presence of salt at low temperatures and metabolize lactic and citric acids, properties that distinguish it from conventional expression systems like Saccharomyces cerevisiae . Although normally considered non-pathogenic, it is related to pathogenic yeasts like Candida albicans, which adds comparative value to its study . The yeast's homothallic nature with a predominantly haplontic life cycle and a single mating-type locus makes it an interesting model for studying nuclear fusion proteins like KAR5 .

How does KAR5 function in nuclear membrane fusion during mating?

KAR5 encodes a novel protein that plays a central role in nuclear membrane fusion during yeast mating. The protein is specifically induced during the mating process, indicating its specialized role in sexual reproduction . KAR5 localizes to the initial site of nuclear fusion, adjacent to the spindle pole body, which acts as a microtubule organizing center in fungi . Analysis of KAR5 indicates it is membrane-bound, with the majority of the protein positioned within the lumen of the endoplasmic reticulum (ER)/nuclear envelope complex . While KAR5 is not likely to function as a membrane fusogen or receptor directly linking nuclei for docking (since it is sequestered within the ER), it appears to help determine the timing and location of nuclear membrane fusion or may be required to complete membrane fusion once nuclear contact has been established . In D. hansenii specifically, the role may be adapted to its rare mating events, as this yeast primarily reproduces through somatogamous autogamy forming asci with usually a single spore .

What genomic tools are available for studying KAR5 in D. hansenii?

Researchers studying KAR5 in D. hansenii can leverage several genomic resources and techniques. The D. hansenii genome (strain CBS767) has been fully sequenced and is available through Génolevures, a large-scale comparative genomics project . This genome has also been incorporated into MycoCosm for comparative analyses with other fungal genomes sequenced by the Joint Genome Institute . For genetic manipulation, a CRISPR-Cas9 toolbox has been recently developed for D. hansenii, enabling efficient gene editing . Additionally, in vivo DNA assembly techniques have been successfully demonstrated in D. hansenii, allowing for the co-transformation of up to three different DNA fragments containing 30-bp homologous overlapping overhangs, which are fused in the correct order in a single step . This technique is particularly valuable for high-throughput screening of potential promoters, terminators, and signal peptides to enhance recombinant protein production in D. hansenii .

What are the optimal conditions for expressing recombinant KAR5 in D. hansenii?

The optimal expression conditions for recombinant KAR5 in D. hansenii involve careful consideration of several parameters:

ParameterOptimal ConditionRationale
Salt Concentration5-10% NaClLeverages D. hansenii's halotolerance while maintaining protein folding efficiency
Temperature20-25°CD. hansenii is cryotolerant and demonstrates optimal protein expression at lower temperatures
pH5.0-6.0Based on killer toxin activity studies showing optimal enzyme activity in this range
Media CompositionComplex by-products from dairy industryD. hansenii can effectively utilize complex nutrients from industrial by-products
Promoter SystemTEF1 promoter (Arxula adeninivorans)Demonstrated highest production of recombinant proteins in D. hansenii
TerminatorCYC1 terminatorShows efficient transcription termination in D. hansenii

When expressing KAR5 specifically, researchers should induce conditions that mimic mating signals, as KAR5 is naturally induced during the mating process . For laboratory-scale cultivation, both closed (sterile) and open (non-sterile) cultivations have been successfully performed at different scales (1.5 mL, 500 mL, and 1 L) using high-salt media, which naturally selects for D. hansenii and suppresses contaminating microorganisms .

How can researchers assess KAR5 localization and function in D. hansenii?

To assess KAR5 localization and function in D. hansenii, researchers can employ several complementary approaches:

For localization studies:

  • Fluorescent fusion proteins: Creating KAR5-GFP or KAR5-YFP fusion constructs can help visualize the subcellular localization of KAR5 during different stages of the cell cycle and mating .

  • Immunolocalization: Developing specific antibodies against D. hansenii KAR5 for immunofluorescence microscopy studies.

  • Subcellular fractionation: Isolating nuclear envelope fractions to confirm the membrane association of KAR5.

For functional studies:

  • Gene disruption: Using CRISPR-Cas9 to generate KAR5 disruption alleles, similar to those created in other yeast studies with HindIII/KpnI and SacI/HindIII fragments .

  • Complementation assays: Testing if D. hansenii KAR5 can rescue nuclear fusion defects in KAR5-deficient strains of other yeasts.

  • Mating efficiency assays: Quantifying the rate of successful matings in wild-type versus KAR5-modified strains.

  • Membrane fusion assays: Developing in vitro assays to assess nuclear membrane fusion events mediated by KAR5.

The assessment methods should account for D. hansenii's unique characteristics, including its rare mating events and the predominantly haplontic life cycle .

What challenges might researchers face when working with recombinant KAR5 in D. hansenii?

Researchers working with recombinant KAR5 in D. hansenii may encounter several challenges:

  • Expression levels: As a membrane protein positioned within the ER lumen, KAR5 may present expression challenges due to potential ER stress and protein misfolding .

  • Protein purification: Membrane proteins are notoriously difficult to purify while maintaining native conformation.

  • Functional assays: Developing assays that specifically measure nuclear membrane fusion activity can be technically challenging.

  • Genetic redundancy: Other proteins may compensate for KAR5 function when it is deleted or modified.

  • Halotolerance interference: The high salt concentrations optimal for D. hansenii growth may interfere with some protein analysis techniques.

To overcome these challenges, researchers might:

  • Optimize codon usage for D. hansenii

  • Use the TEF1 promoter from Arxula adeninivorans, which has shown the highest production of recombinant proteins in D. hansenii

  • Consider using industrial by-products rich in salt as growth media, which naturally support D. hansenii growth

  • Develop specialized membrane protein purification protocols adapted to high-salt conditions

  • Design control experiments that account for D. hansenii's unique physiology and mating behavior

How does the halotolerant nature of D. hansenii affect KAR5 structure and function?

The extreme halotolerance of D. hansenii (up to 24% salinity) likely imposes unique evolutionary pressures on membrane proteins like KAR5 . Researchers investigating this relationship should consider:

  • Protein structure adaptations: KAR5 in D. hansenii may possess unique structural features that maintain function in high-salt environments. Comparative structural analysis with KAR5 from non-halotolerant yeasts could reveal salt-adaptive modifications.

  • Membrane composition interactions: D. hansenii alters its membrane composition in response to salt stress, which may affect how KAR5 is anchored and functions within the nuclear envelope.

  • Protein stability mechanisms: Post-translational modifications specific to D. hansenii may stabilize KAR5 under osmotic stress.

  • Nuclear fusion mechanics: The mechanics of nuclear membrane fusion may differ in high-salt conditions, potentially requiring specialized properties of KAR5.

A systematic approach would involve expressing D. hansenii KAR5 under varying salt concentrations and assessing changes in localization, interaction partners, and functional capacity. Researchers might also investigate whether KAR5 expression is regulated as part of the yeast's halotolerance response pathways.

What is the relationship between KAR5 and the mating behavior of D. hansenii?

D. hansenii exhibits a predominantly haplontic life cycle with rare mating events primarily through somatogamous autogamy, forming asci containing generally a single spore . This unusual mating behavior raises important questions about KAR5 function:

  • Temporal expression: When exactly is KAR5 expressed during the rare mating events of D. hansenii? Is it constitutively expressed at low levels or sharply induced during mating?

  • Functional necessity: Is KAR5 absolutely required for the somatogamous autogamy process, or are there alternative pathways?

  • Evolutionary implications: Has the reduced frequency of mating in D. hansenii led to evolutionary changes in KAR5 function compared to more frequently mating yeasts?

To investigate these questions, researchers could develop mating-inducible systems for D. hansenii and monitor KAR5 expression and localization throughout the process. Comparative genomics approaches examining KAR5 sequence conservation across multiple Debaryomyces species with varying mating frequencies could also provide evolutionary insights.

How can recombinant KAR5 be utilized in studying broader aspects of nuclear membrane biology?

Recombinant KAR5 from D. hansenii represents a valuable tool for investigating fundamental questions in nuclear membrane biology:

  • Comparative membrane fusion mechanisms: KAR5 from the halotolerant D. hansenii may reveal novel principles of membrane fusion under osmotic stress that apply broadly to eukaryotic cell biology.

  • Evolution of nuclear membrane fusion machinery: Comparing KAR5 from D. hansenii with homologs from diverse fungi could illuminate the evolutionary trajectory of nuclear fusion proteins.

  • Biomimetic applications: Understanding how KAR5 facilitates membrane fusion in high-salt environments could inform the design of synthetic membrane fusion systems for biotechnology.

  • Cell biology research tools: Recombinant KAR5 domains could potentially be used to develop targeted nuclear envelope manipulation tools.

Researchers might develop in vitro reconstitution systems using purified recombinant KAR5 and artificial membrane systems to dissect the minimal components required for nuclear membrane fusion under varying salt conditions.

What strategies can be employed to improve recombinant KAR5 expression in D. hansenii?

Optimizing recombinant KAR5 expression in D. hansenii requires specialized strategies due to its membrane-bound nature and the yeast's unique physiology:

Optimization StrategyImplementation ApproachExpected Outcome
Promoter selectionUse TEF1 promoter from Arxula adeninivoransHighest level of recombinant protein production
Codon optimizationAdjust codons based on D. hansenii preferenceImproved translation efficiency
Signal sequence modificationTest various ER-targeting signalsBetter membrane integration
Growth media formulationUtilize industrial by-products rich in saltCost-effective production with natural selection for D. hansenii
Expression temperatureLower cultivation temperature (20-25°C)Improved protein folding for membrane proteins
Fusion tagsN- or C-terminal tags for detection/purificationEasier tracking and purification without functional interference
In vivo DNA assemblyCo-transform multiple DNA fragments with homologous overlapsRapid screening of expression constructs

The feasibility of performing in vivo DNA assembly with up to three different DNA fragments containing 30-bp homologous overlapping overhangs has been demonstrated in D. hansenii, providing a valuable tool for rapidly testing different expression constructs . This technique can be used to screen various promoters, terminators, and signal peptides to enhance recombinant KAR5 production.

How can researchers effectively purify and characterize recombinant KAR5?

Purifying and characterizing membrane proteins like KAR5 presents unique challenges. For D. hansenii KAR5, researchers should consider:

Purification approach:

  • Detergent screening: Test multiple detergents to identify those that effectively solubilize KAR5 while maintaining its native conformation.

  • Affinity chromatography: Engineer affinity tags (His, FLAG, etc.) at positions that don't interfere with KAR5 function.

  • Salt gradient techniques: Exploit D. hansenii's halotolerance by using salt gradients during purification.

  • Membrane fractionation: Isolate nuclear envelope fractions prior to solubilization to reduce contaminating proteins.

Characterization methods:

  • Circular dichroism spectroscopy: Assess secondary structure under varying salt conditions.

  • Limited proteolysis: Map accessible regions and domain boundaries.

  • Crosslinking studies: Identify interaction partners in the nuclear envelope.

  • Nuclear membrane fusion assays: Develop in vitro assays using purified components to reconstitute membrane fusion activity.

For functional characterization, researchers could adapt the streak-plate agar diffusion bioassay and agar diffusion well bioassay approaches that have been used to study killer toxin activity in D. hansenii . These could be modified to assess nuclear fusion efficiency under different conditions.

What bioinformatic approaches are useful for analyzing D. hansenii KAR5?

Bioinformatic analysis of D. hansenii KAR5 can provide valuable insights into its structure, function, and evolution:

  • Comparative sequence analysis: Align KAR5 sequences from multiple yeast species, particularly comparing halotolerant and non-halotolerant species to identify potential salt-adaptation signatures.

  • Structural prediction: Use advanced protein structure prediction tools (AlphaFold, RoseTTAFold) to model KAR5 structure, focusing on membrane-spanning regions and lumenal domains.

  • Phylogenetic analysis: Construct phylogenetic trees of KAR5 across fungi to understand its evolutionary history in relation to mating systems and salt tolerance.

  • Promoter analysis: Examine the KAR5 promoter region for regulatory elements related to mating, salt stress, and cell cycle regulation.

  • Protein-protein interaction prediction: Identify potential interaction partners based on conserved binding motifs.

These analyses can be performed using the genome sequence of D. hansenii strain CBS767, which has been fully sequenced and is available through Génolevures . The integration of D. hansenii's genome into MycoCosm further facilitates comparative genomic analyses with other fungal species .

How might KAR5 research in D. hansenii contribute to understanding nuclear membrane dynamics in extremophiles?

D. hansenii's remarkable ability to thrive in high-salt environments makes it an excellent model for studying how nuclear membrane proteins like KAR5 function under extreme conditions. Future research could explore:

  • Salt-adaptation mechanisms: Investigating how KAR5 maintains structural integrity and function in high-salt environments could reveal general principles of protein adaptation to extreme conditions.

  • Comparative nuclear envelope studies: Systematic comparison of nuclear envelope composition and dynamics between D. hansenii and non-halotolerant yeasts could identify key adaptations.

  • Stress response integration: Examining how nuclear membrane fusion machinery responds to and integrates with cellular stress response pathways in extremophiles.

  • Evolutionary conservation: Determining which aspects of KAR5 function are conserved across diverse environments and which have adapted to specific niches.

This research would not only advance our understanding of D. hansenii biology but could also inform studies of nuclear envelope dynamics in other extremophilic eukaryotes.

What potential applications exist for recombinant D. hansenii KAR5 in research?

Recombinant KAR5 from D. hansenii has several potential research applications:

  • Membrane fusion studies: As a model protein for studying membrane fusion mechanisms under osmotic stress.

  • Biotechnological tools: Development of membrane-targeting systems that function in high-salt environments.

  • Comparative cell biology: Tools for investigating differences in nuclear envelope dynamics across diverse fungi.

  • Structural biology research: Model system for studying membrane protein adaptation to extreme environments.

  • Evolutionary studies: Investigating the co-evolution of mating systems and nuclear fusion machinery.

Researchers might also explore using D. hansenii as a host for expressing other membrane proteins that are challenging to express in conventional systems, leveraging the yeast's unique physiology and recently developed genetic tools .

What interdisciplinary approaches could enhance KAR5 research in D. hansenii?

Advancing our understanding of KAR5 in D. hansenii would benefit from integrating multiple scientific disciplines:

  • Synthetic biology: Designing minimal nuclear fusion systems based on KAR5 and testing them in synthetic membrane systems.

  • Cryo-electron microscopy: Visualizing KAR5 in its native membrane environment at high resolution.

  • Computational biology: Molecular dynamics simulations of KAR5 function under varying salt concentrations.

  • Systems biology: Mapping the interaction network of KAR5 within the broader context of nuclear envelope maintenance and mating pathways.

  • Industrial biotechnology: Exploring how D. hansenii's nuclear fusion machinery might be harnessed for biotechnological applications, such as improving yeast strain development for industrial use.

Combining these approaches with the newly available genetic tools for D. hansenii could rapidly advance our understanding of this protein's unique properties in a halotolerant context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.