Recombinant Debaryomyces hansenii Palmitoyltransferase ERF2 (ERF2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Please note: Our proteins are standardly shipped with blue ice packs. If dry ice shipment is required, please communicate this in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
ERF2; DEHA2G15972g; Palmitoyltransferase ERF2; DHHC cysteine-rich domain-containing protein ERF2; Ras protein acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
ERF2
Target Protein Sequence
MSRRERYSVEPIPNDANEFQDNVSFIHKFITNWLITDPSLRNPGSEKNVKAKNYQVQKHE NVQFIYLCGGRLRSVKQKPINVVTGISILIPGILFWIFEAKWIWFHVNPSIVILFSYFWL ITVSFFIKASMSDPGMLPRNIHVPYSISNANTSPKASPPDEYFNIISLPYNAEDHTGVGL KYCATCHIWRSPRASHCSVCNSCIISHDHHCVFLNNCIGYRNYKYFLWFLLFAVLGCILM SVISFIHVFYYRLGMETSVSTFRSSISKYPVSFLLCIYSLLALVYPFPLLIFHIFLTSYN LTTREYFNNVRGVKNSQNHFTNHFDTHSIFKNLYINWLGRARGFSLVRQTDSYQIGDLRF EKLDPLQSFSS
Uniprot No.

Target Background

Function
The ERF2-ERF4 complex functions as a palmitoyltransferase specifically targeting Ras proteins.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii Palmitoyltransferase ERF2?

Debaryomyces hansenii Palmitoyltransferase ERF2 is a DHHC cysteine-rich domain-containing protein that functions as a Ras protein acyltransferase. This enzyme belongs to the palmitoyltransferase family (EC 2.3.1.-) and plays a crucial role in protein palmitoylation processes in D. hansenii, a halotolerant yeast species . The protein is encoded by the ERF2 gene (locus name: DEHA2G15972g) and consists of 371 amino acids forming a full-length protein . Structurally, the protein contains transmembrane domains and the characteristic cysteine-rich DHHC domain that is essential for its catalytic activity in transferring palmitate to substrate proteins.

What are the optimal storage conditions for recombinant D. hansenii ERF2?

For optimal stability and activity preservation, recombinant D. hansenii ERF2 should be stored in a Tris-based buffer containing 50% glycerol at -20°C . For extended storage periods, conservation at -80°C is recommended . To maintain protein integrity, it's advisable to avoid repeated freezing and thawing cycles. When working with the protein, prepare small working aliquots that can be stored at 4°C for up to one week . This storage protocol helps maintain the structural integrity and enzymatic activity of the protein, which is particularly important for downstream functional assays.

Why is D. hansenii considered a valuable expression system for recombinant proteins?

Debaryomyces hansenii possesses several distinctive characteristics that make it particularly valuable as an expression system for recombinant proteins:

  • Halotolerance: D. hansenii can grow in environments with high salt concentrations, allowing for non-sterile cultivation conditions that naturally inhibit contaminating microorganisms .

  • Resistance to inhibitors: The yeast demonstrates remarkable tolerance to various fermentation inhibitors such as furfural, vanillin, and organic acids .

  • Byproduct utilization: It effectively grows on complex industrial by-products, especially those rich in salt, making it economically and environmentally advantageous .

  • Protein secretion capability: D. hansenii has good capacities to secrete proteins, which simplifies downstream processing and purification steps .

  • Stability in harsh conditions: Proteins produced by D. hansenii can remain stable even in environments with high salt concentration (1 M NaCl) and osmolarity for extended periods (up to 140 hours) .

These properties collectively make D. hansenii an excellent candidate for industrial biotechnology applications, particularly for the production of recombinant proteins using complex or waste feedstocks.

What genetic modification tools are available for D. hansenii?

Recent advances have significantly expanded the genetic toolkit available for D. hansenii manipulation:

  • CRISPR-Cas9 System: An efficient CRISPR-Cas9 toolbox has been developed specifically for D. hansenii, enabling precise genetic modifications . This system has been optimized to account for the unique characteristics of D. hansenii's genome and physiology.

  • In vivo DNA Assembly: Researchers have demonstrated the feasibility of performing in vivo DNA assembly in D. hansenii, allowing for the fusion of up to three different DNA fragments with 30-bp homologous overlapping overhangs in a single-step co-transformation . This technique streamlines the generation of transformant strains for high-throughput screenings.

  • Deletion Cassettes: Multiple resistance markers, including hygromycin (pHygR), kanamycin (pKanR), and nourseothricin (pSAT1) have been adapted for creating gene deletion constructs in D. hansenii . These can be used with either long flanking regions (500-1000 bp) or shorter 50 bp flanking regions introduced by PCR .

  • Integration Cassettes: Genome integration systems have been developed that allow for GFP tagging in the D. hansenii genome using constitutive heterologous promoters such as MgACT1 .

  • Transformation Methods: Electroporation protocols have been specifically optimized for D. hansenii to increase transformation efficiency .

When designing genetic modification experiments in D. hansenii, researchers should consider the organism's unique codon usage preferences and potential differences in promoter strength compared to other yeast species.

How can protein expression be optimized in D. hansenii?

Optimization of protein expression in D. hansenii involves several key considerations:

Promoters and Terminators:

PromoterTerminatorRelative ExpressionSourceNotes
TEF1 (A. adeninivorans)CYC1 (S. cerevisiae)Highest Best combination for YFP expression
MgACT1-Good Proven for GFP expression
Native D. hansenii promotersNative terminatorsVariable-May be optimal for specific proteins

Signal Peptides for Secretion:
D. hansenii can effectively utilize the α-mating factor (MF) signal peptide from Saccharomyces cerevisiae to secrete recombinant proteins into the extracellular medium . The secreted proteins remain stable in the supernatant for extended periods (up to 140 hours) despite high salt concentrations (1 M NaCl) .

Growth Media Considerations:
For optimal expression, D. hansenii can be cultivated in:

  • Salt-rich industrial by-products from dairy and pharmaceutical industries without requiring nutritional supplements or freshwater

  • Open (non-sterile) cultivations at different scales (1.5 mL, 500 mL, and 1 L)

Expression Screening Method:
A systematic approach to identifying optimal expression conditions includes:

  • Co-transformation of DNA fragments containing the gene of interest, various promoters, and terminators

  • In vivo assembly in D. hansenii

  • High-throughput screening of the resulting transformants using fluorescent proteins like YFP as reporters

This workflow enables rapid identification of the best expression parameters for specific recombinant proteins.

What methodologies are effective for assessing D. hansenii ERF2 activity in vitro?

Assessing the enzymatic activity of D. hansenii Palmitoyltransferase ERF2 requires specialized techniques due to the membrane-associated nature of the protein and its specific catalytic function. Based on approaches used for similar enzymes, the following methodologies are recommended:

1. Palmitoylation Assays:

  • Acyl-Biotin Exchange (ABE): This technique involves three steps: (i) blocking free thiols with N-ethylmaleimide, (ii) cleaving thioester bonds with hydroxylamine, and (iii) biotinylating newly exposed thiols for detection with streptavidin-based methods.

  • Click Chemistry-Based Detection: Using alkyne-labeled palmitate analogs that can be subsequently conjugated to reporter molecules via copper-catalyzed azide-alkyne cycloaddition.

2. Substrate Identification:

  • Proximity-Based Labeling: Fusion of ERF2 with enzymes like BioID or APEX2 that can biotinylate proteins in close proximity, followed by streptavidin pull-down and mass spectrometry.

  • Yeast Two-Hybrid Screening: Using a modified membrane yeast two-hybrid system to identify protein-protein interactions involving ERF2.

3. Functional Complementation:

  • Cross-Species Functional Assays: Testing whether D. hansenii ERF2 can complement the function of ERF2 in other yeasts such as S. cerevisiae, particularly in erf2Δ mutants showing defects in Ras localization.

4. Structural Analysis:

  • Membrane Protein Solubilization: Using appropriate detergents or nanodiscs to solubilize and stabilize ERF2 for structural studies.

  • Cysteine Accessibility Assays: Probing the reactivity of the DHHC motif cysteine residues under different conditions to understand the catalytic mechanism.

When adapting these methodologies, it's essential to account for D. hansenii's halotolerant nature, as the high salt environments may affect protein folding and activity compared to enzymes from conventional model organisms.

How does D. hansenii ERF2 compare to homologous proteins in other yeasts?

D. hansenii ERF2 shares functional similarities with other yeast DHHC palmitoyltransferases but exhibits distinctive features that reflect its adaptation to D. hansenii's unique ecological niche:

Comparative Sequence Analysis:

SpeciesProteinIdentity to DhERF2Key Functional DomainsNotable Differences
D. hanseniiERF2100%DHHC domain, transmembrane regionsAdapted to high-salt environments
S. cerevisiaeERF2~60-70% (estimated)DHHC domain, transmembrane regionsFunctions in complex with ERF4
C. glabrataERF2~65% (estimated)DHHC domain, transmembrane regionsPathogenicity-related functions

Functional Conservation and Divergence:
While the core DHHC domain and catalytic mechanism are likely conserved across species, D. hansenii ERF2 may have evolved specific adaptations to function optimally in high-salt environments. The enzyme likely maintains its role in protein palmitoylation, particularly for Ras proteins, but could have acquired substrate specificities unique to D. hansenii's cellular processes .

Expression and Regulation:
Unlike S. cerevisiae where ERF2 functions in a complex with ERF4, it remains to be determined whether D. hansenii ERF2 requires similar protein partners for optimal activity. The regulation of ERF2 expression in D. hansenii may also differ, potentially responding to osmotic stress conditions that are relevant to this halotolerant organism.

Research Gap:
A comprehensive comparative analysis of D. hansenii ERF2 with its homologs from other yeasts represents an important research opportunity that could provide insights into how protein palmitoylation mechanisms have evolved across diverse fungal lineages adapted to different ecological niches.

What role does D. hansenii ERF2 play in cellular adaptation to salt stress?

The role of ERF2 in D. hansenii's remarkable salt tolerance remains an intriguing research question. Based on the function of palmitoyltransferases in other organisms and D. hansenii's halotolerant nature, several hypotheses emerge:

Potential Mechanisms in Salt Adaptation:

  • Membrane Protein Modification: ERF2-mediated palmitoylation may regulate the localization and activity of membrane transporters involved in ion homeostasis during salt stress. The modification of proteins with palmitate can alter their membrane association, potentially affecting the structure and function of membrane proteins critical for salt tolerance.

  • Signaling Pathway Regulation: By palmitoylating key components of stress response pathways (particularly Ras proteins, given ERF2's classification as a Ras protein acyltransferase ), ERF2 may modulate signaling cascades that govern adaptation to osmotic stress.

  • Protein Stability Enhancement: Palmitoylation could enhance the stability of certain proteins in high-salt environments, contributing to D. hansenii's ability to maintain cellular functions under conditions that would denature proteins in less adapted organisms.

Research Approaches to Investigate This Role:

  • Comparative Proteomics: Analysis of the palmitoylated proteome in D. hansenii under normal versus high-salt conditions using techniques like acyl-biotin exchange coupled with mass spectrometry.

  • Phenotypic Analysis of ERF2 Mutants: Creation of ERF2 deletion or catalytically inactive mutants using CRISPR/Cas9 or other genetic tools available for D. hansenii , followed by assessment of salt tolerance phenotypes.

  • Subcellular Localization Studies: Examination of how ERF2 localization changes in response to salt stress, using GFP tagging approaches established for D. hansenii .

  • Integration with Systems Biology: Correlation of ERF2 activity with global gene expression and metabolic changes during salt adaptation.

Understanding ERF2's role in salt adaptation could have broader implications for engineering salt tolerance in other organisms and provide insights into fundamental mechanisms of protein modification in extremophilic adaptation.

What are the recommended approaches for purifying active D. hansenii ERF2?

Purifying active D. hansenii ERF2 presents significant challenges due to its membrane-associated nature and the need to maintain its native conformation. Based on approaches used for similar enzymes, the following methodology is recommended:

Expression System Optimization:

  • Express recombinant D. hansenii ERF2 with appropriate fusion tags (e.g., His6, FLAG, or Strep-tag II) positioned to minimize interference with the DHHC active site

  • Consider using the native D. hansenii expression system, leveraging the TEF1 promoter and CYC1 terminator combination that has shown high expression efficiency

Membrane Protein Extraction:

  • Harvest cells and disrupt cell walls using methods optimized for D. hansenii (e.g., mechanical disruption with glass beads)

  • Prepare membrane fractions through differential centrifugation

  • Solubilize membranes using detergents that maintain protein activity:

DetergentConcentrationAdvantagesLimitations
n-Dodecyl-β-D-maltoside (DDM)0.5-1%Mild, preserves activityLess efficient extraction
Digitonin0.5-2%Good for complexesExpensive
CHAPS0.5-1%Good for enzymatic assaysVariable efficiency

Purification Strategy:

  • Perform affinity chromatography using the introduced tag under conditions optimized for membrane proteins (detergent above CMC)

  • Consider including stabilizing agents such as glycerol (10-20%) and salt (100-500 mM NaCl, leveraging D. hansenii's halotolerance)

  • Conduct size exclusion chromatography to remove aggregates and obtain a homogeneous preparation

  • Validate the purity by SDS-PAGE and the activity using palmitoylation assays

Alternative Approaches:

  • Reconstitution into nanodiscs or liposomes post-purification to better mimic the native membrane environment

  • Consider expressing minimal constructs containing just the catalytic domain if full-length protein purification proves challenging

When adapting these protocols, it's essential to maintain appropriate quality control measures, including assessing protein activity at each purification step to ensure the final preparation retains catalytic function.

How can in vivo DNA assembly be optimized for creating D. hansenii ERF2 variants?

The in vivo DNA assembly technique demonstrated in D. hansenii offers a powerful approach for creating and screening ERF2 variants. Based on the information from the search results, the following optimization strategy is recommended:

Optimal Design of DNA Fragments:

  • Design DNA fragments with 30-bp homologous overlapping overhangs between adjacent fragments

  • Limit the total number of fragments to three for optimal assembly efficiency

  • Ensure high-quality PCR products free of non-specific amplification

Transformation Protocol:

  • Prepare D. hansenii cells for high transformation efficiency using optimized electroporation protocols

  • Co-transform all DNA fragments simultaneously

  • Use an appropriate selectable marker system (hygromycin, kanamycin, or nourseothricin resistance)

Assembly Efficiency Enhancement:

  • Consider including a recombination enhancer sequence if assembly efficiency is low

  • Optimize the molar ratio of fragments (typically using equimolar amounts as a starting point)

  • Increase homology arm length beyond 30 bp for complex assemblies

Screening Strategy:
For creating and evaluating ERF2 variants:

  • Design a screening system that links ERF2 function to a selectable or detectable phenotype

  • Consider using fluorescent reporter systems similar to the YFP approach used successfully in D. hansenii

  • Implement high-throughput screening methods to evaluate multiple variants simultaneously

Validation of Correct Assembly:

  • PCR verification spanning fragment junctions

  • Sequencing of the entire assembled construct

  • Functional validation of the expressed protein

This approach allows for rapid creation of ERF2 variants with modifications to domains of interest, enabling structure-function studies and protein engineering efforts to enhance or modify the enzyme's properties for biotechnological applications.

How can D. hansenii ERF2 be leveraged for biotechnological applications?

The unique properties of D. hansenii ERF2, combined with the organism's halotolerance and ability to utilize industrial by-products, present several promising biotechnological applications:

Engineered Protein Palmitoylation Systems:

  • Development of controlled protein palmitoylation platforms for modifying therapeutic proteins or industrial enzymes

  • Creation of biosensors based on palmitoylation-dependent protein localization or interaction

  • Engineering of membrane protein targeting systems for displaying enzymes or binding proteins on cell surfaces

Sustainable Bioprocessing:

  • Integration of ERF2 expression with D. hansenii's ability to grow on salt-rich industrial by-products

  • Development of non-sterile, open cultivation processes leveraging the selective advantage provided by high salt concentrations

  • Creation of consolidated bioprocesses where protein production and modification occur simultaneously

Research Tools:

  • Development of ERF2-based tools for studying protein palmitoylation in heterologous systems

  • Creation of affinity-tagged ERF2 variants for capturing and identifying novel palmitoylation substrates

  • Engineering of ERF2 with altered substrate specificity for selective protein modification

Implementation Strategy:

  • Characterize the substrate specificity and activity parameters of D. hansenii ERF2

  • Optimize expression and activity under industrial conditions

  • Develop process integration protocols that leverage D. hansenii's unique physiological properties

  • Scale-up demonstration focused on economically relevant targets

These applications align with growing trends toward sustainable bioprocessing and protein engineering for specialized applications in biotechnology and biopharmaceuticals.

What are the critical research gaps in understanding D. hansenii ERF2 function?

Despite the potential significance of D. hansenii ERF2 in both basic research and biotechnological applications, several critical knowledge gaps remain:

Structural Characterization:

  • The three-dimensional structure of D. hansenii ERF2 has not been determined

  • The exact mechanism of palmitate transfer and the structural basis for substrate recognition remain unclear

  • The potential requirement for protein partners (similar to S. cerevisiae ERF2/ERF4 complex) is unknown

Physiological Roles:

  • The complete set of native substrates for D. hansenii ERF2 has not been identified

  • The role of ERF2-mediated palmitoylation in D. hansenii's remarkable salt tolerance is unexplored

  • The regulatory mechanisms controlling ERF2 expression and activity remain to be characterized

Biotechnological Parameters:

  • Optimal conditions for ERF2 activity in industrial settings are undetermined

  • The potential for engineering ERF2 for altered substrate specificity or enhanced stability lacks investigation

  • Integration of ERF2 function with D. hansenii's capacity for utilizing complex feedstocks needs exploration

Research Priorities:

  • Comprehensive proteomics studies to identify the D. hansenii palmitoylosome

  • Structural studies of ERF2 alone and in complex with substrates

  • Functional genomics approaches to place ERF2 within D. hansenii's cellular networks

  • Applied research on ERF2's potential in protein engineering and modification

Addressing these knowledge gaps would not only advance our fundamental understanding of protein palmitoylation in extremophilic yeasts but also enable novel biotechnological applications leveraging D. hansenii's unique physiological properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.