Recombinant Debaryomyces hansenii Palmitoyltransferase SWF1 (SWF1)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

SWF1 is a palmitoyltransferase (EC 2.3.1.-) from the halophilic yeast Debaryomyces hansenii. The recombinant form is produced in E. coli with an N-terminal His tag, enabling purification via affinity chromatography . Key features include:

PropertySpecification
UniProt IDQ6BP23
Amino Acid Sequence377 residues (Full-length: 1-377 aa)
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Molecular FunctionCatalyzes protein S-palmitoylation, enhancing membrane association of substrates.
Expression SystemE. coli
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Biotechnological Applications

D. hansenii is a robust platform for recombinant protein production due to its halotolerance and ability to thrive in high-salt industrial side-streams . While SWF1 is currently produced in E. coli, studies demonstrate D. hansenii’s potential as a host for recombinant proteins under non-sterile, high-salt conditions . For example:

  • YFP Production: Recombinant D. hansenii strains produced yellow fluorescent protein (YFP) in salty by-products, with yields linked to biomass growth .

  • CRISPR-Cas9 Engineering: Advanced genetic tools enable strain optimization for enhanced protein secretion .

Key Findings from D. hansenii Studies:

  • Salt Tolerance Mechanisms: Omics studies reveal differential responses to NaCl vs. KCl, highlighting ion transporters and lipid metabolism adaptations .

  • Industrial By-Product Utilization: Waste streams like salty flowthrough (SF) support recombinant protein production without compromising yield .

Challenges and Considerations

  • Functional Characterization: The enzyme’s substrate specificity and kinetic parameters remain unstudied.

  • Host System Limitations: E. coli lacks post-translational modification machinery present in eukaryotes, potentially affecting activity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to concentrate the contents. Please reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please communicate it to us, and we will prioritize development according to your specification.
Synonyms
SWF1; DEHA2E17138g; Palmitoyltransferase SWF1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
SWF1
Target Protein Sequence
MSLPFTVIICIVLLSAILISIVIFGNSPNFRNTPIYKLRLKILRWNHDIIAWINYVDSHV FGNKLVFYSGWLVPLFYIIVVSFCLHQFFTKVYKLLPLFVRKSGFHSTYIAFTILCIFID TFMATFSNPGKITTGNVDKVDNFFQNNELIFFADNYCSTCEIIKPARSKHCSICNNCIML FDHHCIWVNNCVGYYNYKWFMGFLIANINLLGYGGYLCYQAMSSTKTEFPTLSYWKTIIS TNDSNKATGVLLILCVIFIMIAVLFTGLHLRYLYLGVTTNECDKWSEVEYLISLGSLYQV IDSNLNEKYVEKCVIMNHDNDSYETVFISLKNENVLFSSNDGINLRKIESMEDDLINIYD HGFVDNLKERMFNRVLN
Uniprot No.

Target Background

Function
Palmitoyltransferase that targets several endosomal SNAREs. It palmitoylates these SNAREs at cysteine residues located near the cytoplasmic end of their transmembrane domain. This enzyme may play a role in cellular quality control of transmembrane domain-containing proteins.
Database Links
Protein Families
DHHC palmitoyltransferase family, SWF1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii Palmitoyltransferase SWF1?

Palmitoyltransferase SWF1 (SWF1) is a full-length protein (377 amino acids) found in Debaryomyces hansenii. It belongs to the enzyme class EC 2.3.1.- and plays a role in the post-translational modification of proteins through palmitoylation. The recombinant version is typically expressed with an N-terminal His tag in E. coli expression systems to facilitate purification and experimental manipulation . The UniProt ID for this protein is Q6BP23, and its gene is designated as SWF1 with ordered locus name DEHA2E17138g .

How does the halophilic nature of D. hansenii affect experimental design when working with SWF1?

When designing experiments involving recombinant D. hansenii SWF1, researchers must account for the organism's halophilic nature. Controlled bioreactor studies have shown that D. hansenii exhibits optimal growth rates in the presence of 1M NaCl, closely followed by 1M KCl . This finding contradicts previous assertions that sodium is detrimental to cell growth.

When establishing experimental conditions for SWF1 functional studies, researchers should consider:

These considerations ensure that the experimental environment mimics the optimal conditions for D. hansenii, providing more reliable and physiologically relevant results when studying SWF1 function.

What are the differential effects of sodium versus potassium on D. hansenii metabolism and how might this impact SWF1 functionality?

Research in controlled bioreactor environments has revealed distinct effects of sodium and potassium on D. hansenii metabolism, which may impact SWF1 functionality:

These metabolic effects suggest that SWF1's activity and function may be optimized in high sodium environments, particularly at lower pH. Future research should investigate whether SWF1 palmitoylation activity is directly influenced by these ionic conditions.

What molecular mechanisms might explain the differential response to Na+ and K+ in D. hansenii, and how does this relate to SWF1 regulation?

While specific mechanisms regarding SWF1 regulation in response to salt conditions remain to be fully elucidated, research indicates several molecular factors that may explain D. hansenii's differential response to Na+ and K+:

  • Salt-responsive molecular switches: Evidence suggests the existence of molecular elements that specifically respond to the presence of Na+ or K+, triggering distinct metabolic responses. These switches likely differentiate between sodium and potassium to initiate different behavioral patterns .

  • Gene expression changes: Global expression analysis by RNA sequencing in steady-state continuous bioreactor cultivations could reveal how salt concentration affects gene expression, including potential regulation of SWF1 .

  • Metabolic adaptation: The presence of 1M NaCl results in optimal growth rates, suggesting metabolic pathways are optimized under these conditions. SWF1, as a palmitoyltransferase, may play a role in modifying proteins involved in these salt-responsive pathways .

  • Membrane modifications: As a palmitoyltransferase, SWF1 likely modifies membrane-associated proteins, which may be crucial for maintaining membrane integrity and function under varying salt conditions .

Further research is needed to identify the specific regulatory elements controlling SWF1 expression and activity in response to different ionic environments.

What are the optimal expression and purification methods for recombinant D. hansenii SWF1?

Based on available research, the optimal expression and purification methods for recombinant D. hansenii SWF1 include:

Expression System:

  • Heterologous expression in E. coli is the established method for producing recombinant SWF1 protein

  • The full-length protein (1-377 amino acids) is typically fused to an N-terminal His tag to facilitate purification

Purification Protocol:

  • Initial processing: Centrifugation of expression culture, followed by cell lysis

  • Affinity chromatography: His-tagged SWF1 can be purified using nickel or cobalt affinity resins

  • Elution: Using imidazole-containing buffers in a gradient or step elution strategy

  • Quality assessment: SDS-PAGE analysis should confirm >90% purity

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Use Tris/PBS-based buffer with 6% trehalose (pH 8.0) for storage

Reconstitution Guidelines:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

These methodological considerations ensure maximum protein stability and activity for subsequent experimental applications.

How can researchers optimize experimental conditions for studying SWF1 activity in vitro?

To optimize experimental conditions for studying SWF1 activity in vitro, researchers should consider the following methodological approaches:

Buffer Composition:

  • Salt concentration: Include 1M NaCl in reaction buffers to mimic the optimal physiological environment of D. hansenii

  • pH optimization: Test a range of pH values (4-8), with particular attention to lower pH values (4-6) which show synergistic effects with high sodium concentrations

  • Carbon source: Consider glucose concentration effects, as limited glucose (0.2%) shows interesting interactions with salt concentrations

Temperature Considerations:

  • Activity assays should be performed at 26-30°C, the optimal temperature range for D. hansenii growth

  • Test multiple temperatures within this range to determine the optimal temperature for SWF1 activity

Substrate Selection:

  • As a palmitoyltransferase, SWF1 requires palmitoyl-CoA as a donor substrate

  • Test multiple potential protein substrates, focusing on membrane-associated proteins that might be natural targets

Activity Measurement:

  • Develop appropriate assays to measure palmitoylation of target proteins

  • Consider using radioactive [³H]-palmitoyl-CoA or click chemistry-based approaches with alkyne-modified palmitoyl-CoA analogues

Controls:

  • Include enzymatically inactive mutants (potentially targeting conserved cysteine residues) as negative controls

  • Use known palmitoyltransferase/substrate pairs as positive controls to validate assay conditions

These optimized conditions will facilitate more accurate assessment of SWF1's enzymatic properties and substrate preferences in vitro.

What stress pretreatment methods can enhance the stability and activity of D. hansenii cells when studying SWF1 function?

Research indicates that specific stress pretreatment methods can enhance D. hansenii stability and potentially affect SWF1 function:

Polyol Pretreatment:

Salt Acclimation:

  • Gradual acclimation to high salt concentrations (starting with 0.5M and increasing to 1-2M NaCl) can prepare cells for optimal performance

  • This approach reduces lag phase when transferring to high-salt experimental conditions

pH Adaptation:

  • Adaptation to lower pH values (pH 4-6) in combination with high sodium concentrations demonstrates synergistic positive effects on cell growth

  • This approach may optimize cellular conditions for native SWF1 function

Carbon Source Optimization:

  • Limited glucose availability (0.2%) in combination with high salt shows distinctive effects on cell performance

  • This condition may trigger metabolic states where SWF1 function is particularly relevant

Temperature Conditioning:

  • Pretreating cells at different temperatures within the 26-30°C range may optimize cellular machinery for subsequent experiments

These pretreatment approaches can be systematically tested to determine which conditions optimize SWF1 expression, stability, and function within its native cellular context.

How does the halophilic nature of D. hansenii influence research applications of SWF1 in protein modification studies?

Recent research clarifying D. hansenii's halophilic nature has significant implications for SWF1 research applications:

  • Native environment reconstitution: Studies of SWF1 should incorporate high salt conditions (optimally 1M NaCl) to replicate the protein's native environment, potentially affecting its conformation and activity .

  • Substrate specificity: The halophilic environment may influence SWF1's substrate recognition and specificity. Researchers should consider whether palmitoylation targets are differentially modified under varying salt conditions.

  • Structural adaptations: SWF1 may possess structural features that optimize its function in high-salt environments. Comparative studies with palmitoyltransferases from non-halophilic organisms could reveal salt-adaptive protein features.

  • Specialized applications: SWF1 may have unique applications in protein modification studies requiring high salt tolerance, such as modification of halophilic proteins that denature under low-salt conditions.

  • Biotechnological potential: As noted in the research, D. hansenii has untapped biotechnological potential, and SWF1 might contribute to this through its role in protein modification in extreme conditions .

Future research should investigate whether SWF1's palmitoylation activity varies under different salt concentrations and if this variation serves as an adaptive response to environmental stress.

What are the most promising future research directions for understanding SWF1 function in the context of D. hansenii's halophilic adaptations?

Based on current findings, several promising research directions emerge for understanding SWF1 function in relation to D. hansenii's halophilic adaptations:

  • Global proteomics approach: Investigating the full range of SWF1 substrates through proteomics, comparing palmitoylated proteins under different salt conditions to identify salt-dependent modifications .

  • Structure-function analysis: Determining SWF1's three-dimensional structure through X-ray crystallography or cryo-EM to identify potential salt-binding domains that might regulate its activity.

  • Comparative genomics: Comparing SWF1 from D. hansenii with homologs from non-halophilic yeasts like Saccharomyces cerevisiae to identify unique adaptations that may contribute to function in high-salt environments.

  • Gene knockout studies: Creating SWF1 knockout strains to assess its contribution to salt tolerance mechanisms and identify compensatory pathways.

  • Transcriptomics integration: Combining RNAseq data from continuous bioreactor cultivations with functional studies of SWF1 to understand how gene expression patterns correlate with protein activity under various salt conditions .

  • Identification of salt-responsive molecular switches: Further investigation into the molecular elements that respond differently to Na+ versus K+, potentially involving SWF1-mediated protein modifications .

These approaches would significantly advance understanding of how protein palmitoylation contributes to halophilic adaptation in D. hansenii.

How might understanding D. hansenii SWF1 function contribute to broader biotechnological applications?

The unique properties of D. hansenii SWF1, particularly in the context of the organism's halophilic nature, offer several potential biotechnological applications:

  • Enzyme engineering for extreme conditions: Insights from SWF1's function in high-salt environments could inform the engineering of enzymes that maintain activity under extreme conditions, valuable for industrial bioprocesses .

  • Bioprocess optimization: Understanding how SWF1 contributes to D. hansenii's efficiency in converting carbon sources in high-salt environments could improve bioprocessing strategies, particularly for second-generation bioethanol production from pentoses .

  • Stress-resistant protein production: Knowledge of how protein modifications via SWF1 contribute to stress resistance could enable the development of more robust protein production systems for pharmaceutical and industrial applications.

  • Novel salt-responsive molecular tools: The identification of "molecular switches" that respond to salt conditions could provide novel tools for synthetic biology applications, allowing for salt-inducible gene expression systems .

  • Improved bioremediation strategies: Enhanced understanding of salt tolerance mechanisms involving SWF1 could contribute to developing microorganisms capable of bioremediation in saline environments.

  • Metabolic engineering applications: As noted in the research, D. hansenii has genes with high biotechnological relevance, including those for monocarboxylic acid transport and xylose metabolism for second-generation bioethanol production. Understanding how SWF1 interfaces with these pathways could enhance metabolic engineering efforts .

These applications represent promising avenues for translating fundamental research on D. hansenii SWF1 into practical biotechnological solutions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.