Recombinant Debaryomyces hansenii Peroxisome assembly protein 22 (PEX22)

Shipped with Ice Packs
In Stock

Description

Biological Role in Peroxisome Biogenesis

PEX22 functions as a membrane anchor and co-activator for Pex4p, a ubiquitin-conjugating enzyme (E2) critical for peroxisome protein import and receptor recycling. This interaction is conserved across yeast species, though structural details vary:

  • Pex4p–Pex22 Complex: In Hansenula polymorpha, Pex22p stabilizes Pex4p at the peroxisomal membrane and enhances its enzymatic activity by monoubiquitinating Pex5p (a PTS1 receptor) . While D. hansenii PEX22 shares functional homology, its exact mechanism remains under investigation.

  • Peroxisomal NAD+ Homeostasis: Though PEX22 itself is not directly involved in NAD+ transport, its role in membrane protein import indirectly supports pathways like β-oxidation, which rely on NAD+ shuttles (e.g., Pmp47, Mdh3, Gpd1) .

Recombinant Production and Applications

Recombinant PEX22 is produced for structural and functional studies, leveraging E. coli expression systems. Key applications include:

ApplicationDetailsSource
Structural BiologyCrystallization studies to resolve PEX22–Pex4p interactions
Functional AssaysCo-activation of Pex4p in vitro ubiquitination assays
BiotechnologyEngineering D. hansenii strains for lipid production or stress tolerance

Comparative Analysis with Other Species

PEX22 homologs exist in diverse organisms, with varying lengths and functional motifs:

OrganismLength (aa)TagExpression Host
Debaryomyces hansenii196HisE. coli
Saccharomyces cerevisiae180HisE. coli
Arabidopsis thaliana283HisE. coli

Notably, D. hansenii PEX22 lacks the extended C-terminal domain seen in plant homologs, suggesting distinct evolutionary pressures .

Research Challenges and Future Directions

  • Structural Elucidation: No high-resolution crystal structures for D. hansenii PEX22 exist, unlike H. polymorpha Pex22p .

  • Functional Redundancy: PEX22’s role in NAD+ homeostasis is indirect, requiring further studies to clarify its interplay with Pmp47 or redox shuttles .

  • Biotechnological Engineering: Efficient gene-targeting methods in D. hansenii (e.g., PCR-based homologous recombination) could enable PEX22 overexpression for industrial applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
PEX22; DEHA2F01386g; Peroxisome assembly protein 22; Peroxin-22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
PEX22
Target Protein Sequence
MPQAQIRKTQRNPKLWIAALVAASIVTISYKVYSSYIAEENIEDKKTEGDGGVEEKLRIA KRYTKKSIALTLSHSVLSSQLPLNEILLNSENVTFILPPNLSMDDLVCNIGNADEVERYN LPKTLLNNYKLLHCSNIDGYFNILKNLKPDTLLVCSEDLGIANNVPRDLHRFVKEIINID QNKDDIYKKLSSIFIK
Uniprot No.

Target Background

Function
Involved in peroxisome biogenesis.
Database Links
Protein Families
Peroxin-22 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.