Recombinant Debaryomyces hansenii pH-response regulator protein palH/RIM21 (RIM21)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant RIM21 from Debaryomyces hansenii is a full-length (1-537 amino acids) protein fused to an N-terminal His tag, expressed in E. coli . Key specifications include:

ParameterDetails
UniProt IDQ6BPR6
SpeciesDebaryomyces hansenii
Molecular Weight~60 kDa (predicted)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability

The protein is annotated as a pH-response regulator (synonyms: PalH, RIM21) and shares functional homology with sensors in Saccharomyces cerevisiae and Aspergillus nidulans .

Domain Architecture

  • Transmembrane Domains: RIM21 contains seven transmembrane helices, characteristic of pH-sensing proteins .

  • C-Terminal Cytoplasmic Tail: Critical for interactions with downstream signaling components like Rim8 and ESCRT complexes .

Mechanism of Action

RIM21 operates within the Rim101 pathway:

  1. Alkaline pH Detection: RIM21 senses extracellular alkalinization or plasma membrane depolarization .

  2. Signal Transduction: It recruits Rim8 (arrestin-like protein), which ubiquitinates and activates ESCRT complexes .

  3. Proteolytic Activation of Rim101: The ESCRT-mediated cascade cleaves the transcription factor Rim101, enabling its nuclear translocation to regulate pH-responsive genes .

Key Research Findings

  • Salt Stress Response: D. hansenii RIM21 is implicated in halotolerance, with transcriptomic studies showing differential expression under NaCl/KCl stress .

  • Phosphorylation: RIM21 activity is modulated by phosphorylation, though specific sites in D. hansenii remain uncharacterized .

  • Lipid Asymmetry Sensing: RIM21 detects altered phospholipid distribution in the plasma membrane, a secondary activation mechanism .

Comparative Analysis with Orthologs

RIM21 orthologs in other fungi exhibit conserved roles but divergent regulatory features:

SpeciesProteinFunctionKey Differences
S. cerevisiaeRim21pH sensing, Rim101 activationRequires Dfg16 for plasma membrane localization
C. neoformansRra1Rim101 activationLacks sequence homology but functional overlap
A. nidulansPalHpH sensing, PacC activationDirect interaction with PalF (Rim8 analog)

Applications in Research

  • Mechanistic Studies: Used to dissect pH-responsive signaling pathways in halophilic yeasts .

  • Biotechnological Engineering: Insights into RIM21 function aid in optimizing D. hansenii for industrial processes (e.g., food fermentation, bioremediation) .

  • Protein Interaction Mapping: Recombinant RIM21 facilitates pull-down assays to identify binding partners like Rim9 and Dfg16 .

Research Challenges

  • Stability Issues: The protein requires glycerol supplementation and strict storage at -80°C to prevent aggregation .

  • Functional Redundancy: Overlapping roles with other cation transporters (e.g., DhNha1, DhEna1) complicate phenotypic analyses .

Future Directions

  • Structural Resolution: Cryo-EM studies could elucidate conformational changes during pH sensing.

  • CRISPR-Based Knockouts: To clarify RIM21’s role in D. hansenii’s extremophile adaptations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
RIM21; DEHA2E11396g; pH-response regulator protein palH/RIM21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-537
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
RIM21
Target Protein Sequence
MYWRSDEWQEEIYPACEQLSLPEGLLISQNTSFGSQFISRSIFQQKCYKHSVPMLNTNNG LMLNKFAGLLPIAEQTWHDFTGNSSKGSFAYSVVPVLYSISISAVITWFLNIFVITNYTI KPSILLRASTTLSSIYLLITVIMAIIELHKQQKQGFLHGTKLFDCINSSLALNIIDLIVV FLLQINQVQIIMRIFSRQKDKRLTFFVGIFASITSQVLWAITRFHSFSDDSEAGDILPAF QYLVRIAMGVCYAALVSVFVLMKINYIIANKKIWLITLLTVILIYGPVAFFIADVSNAWV FELSEIFSVVTYDICVVIPWEWCNKYNSIMKAKEKEGVLGRKFYEDELYELDRFELFVDE EDEDHENNNNENDDESGNENDNERGNNDHNNRHGLSRNGENTHKGYRPVNFDGNDKGFGS IFETYRRTKETFLNITDHVIAKGLAIPRSASVFTGTPVSAHNDEVFRMDNLNHKRDDPAD MTLENQEDHRNTNRNNTIRFASNSDIHRTNNSTAQNRRDVFVYSTREVIIDASDTET
Uniprot No.

Target Background

Function
This protein is essential for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Database Links
Protein Families
PalH/RIM21 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the RIM21 protein in Debaryomyces hansenii and what is its primary function?

RIM21 (also known as palH/RIM21) is a pH-response regulator protein found in the halotolerant yeast Debaryomyces hansenii. This protein consists of 537 amino acids and functions primarily as a regulator in pH-responsive pathways. Based on its homology to similar proteins in other yeast species, it plays a critical role in sensing and responding to extracellular pH changes, thus allowing the organism to adapt to varying environmental pH conditions . The protein's role is particularly significant in D. hansenii, which exhibits notable adaptability to high-salt environments and varying pH levels, making it valuable for industrial applications .

What are the recommended storage conditions for recombinant RIM21 protein?

For optimal stability and activity of recombinant RIM21 protein, researchers should follow these methodological guidelines:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 50% for long-term storage

  • Aliquot the protein solution to avoid repeated freeze-thaw cycles, which can degrade the protein

  • Working aliquots can be stored at 4°C for up to one week

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

These storage parameters are critical for maintaining protein integrity during experimental workflows .

What expression systems are most effective for recombinant RIM21 production?

The most documented and effective expression system for recombinant RIM21 is Escherichia coli. When expressing this protein, researchers should consider:

  • Using an N-terminal His-tag for simplified purification via affinity chromatography

  • Optimizing codon usage for E. coli expression, as D. hansenii is a yeast with different codon preferences

  • Inducing expression under controlled temperature conditions (typically 18-25°C) to enhance proper folding

  • Considering the full-length protein (1-537 amino acids) expression may be challenging due to size and potential transmembrane domains; domain-specific expression might yield better results in some experimental contexts

The expressed protein can be effectively purified using nickel affinity chromatography followed by size exclusion chromatography if higher purity is required .

How can I optimize the reconstitution of lyophilized RIM21 protein for experimental use?

To achieve optimal reconstitution of lyophilized RIM21 protein, follow this methodological approach:

  • Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration between 0.1-1.0 mg/mL

  • Allow the protein to fully dissolve by gentle pipetting or rotating (avoid vortexing to prevent denaturation)

  • For long-term storage, add glycerol to a final concentration of 50%

  • Aliquot into smaller volumes to prevent repeated freeze-thaw cycles

  • Verify protein concentration using standard methods (Bradford/BCA assay)

  • Assess protein quality via SDS-PAGE before experimental use

This systematic approach ensures optimal protein availability for downstream applications while minimizing degradation .

What are the key considerations for designing experiments involving pH response in Debaryomyces hansenii?

When designing experiments to study pH response mechanisms involving RIM21 in D. hansenii, researchers should implement the following methodological framework:

  • Include appropriate environmental controls with varying pH levels (typically pH 4-8)

  • Consider the influence of salt concentration, as D. hansenii shows improved performance at pH 4 with high salt content (1M NaCl)

  • Include time-course measurements to capture dynamic pH responses

  • Compare wild-type and RIM21 knockout/mutant strains to establish functional relationships

  • Implement both transcriptomic and proteomic analyses to capture multi-level regulatory responses

  • Monitor key physiological parameters including growth rate, metabolite production, and stress response markers

  • Account for strain-specific responses, as different D. hansenii strains exhibit varied responses to pH and salt stress

This experimental design framework enables comprehensive characterization of RIM21's role in pH sensing and adaptation mechanisms .

How can abiotic stress tolerance be assessed in D. hansenii strains expressing different levels of RIM21?

To systematically evaluate abiotic stress tolerance in relation to RIM21 expression, implement this methodological approach:

  • Generate strains with varying RIM21 expression levels (knockout, wild-type, and overexpression)

  • Design multi-factorial experiments testing combinations of:

    • pH levels (3.0-8.0)

    • Salt concentrations (0-2M NaCl)

    • Temperature ranges (20-40°C)

    • Oxidative stress conditions (H₂O₂ exposure)

  • Employ high-throughput screening methods with automated robotics for consistent results

  • Measure growth parameters using spectrophotometric methods (OD600) at regular intervals

  • Conduct spot-test studies on solid media containing stress factors

  • Perform semi-controlled micro-fermentations to assess metabolic outputs under stress

  • Quantify RIM21 expression levels using RT-qPCR and western blot analysis

  • Correlate expression levels with physiological responses to establish mechanistic relationships

This comprehensive approach provides robust data on RIM21's role in stress adaptation pathways and identifies optimal conditions for strain performance .

How does RIM21 participate in the molecular signaling cascade for pH adaptation in D. hansenii compared to other yeast species?

The molecular signaling mechanisms involving RIM21 in D. hansenii represent a specialized adaptation to extreme environments. When investigating these pathways:

  • Conduct comparative genomics analyses between D. hansenii RIM21 and homologs in model yeasts (S. cerevisiae, C. albicans)

  • Implement phosphoproteomic analyses to identify post-translational modifications and activation mechanisms

  • Use co-immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Apply CRISPR-Cas9 gene editing to generate specific domain mutations for functional mapping

  • Employ fluorescently-tagged RIM21 to visualize subcellular localization under varying pH conditions

  • Analyze downstream gene expression patterns using RNA-Seq after pH shifts

  • Develop computational models incorporating RIM21 signaling components to predict adaptive responses

D. hansenii's RIM21 likely shows distinct regulatory mechanisms compared to non-halophilic yeasts, particularly in its integration of salt and pH signaling pathways, which may explain the species' exceptional tolerance to abiotic stresses .

What methodological approaches can resolve conflicting data regarding RIM21's role in halotolerance versus pH regulation?

When addressing conflicting experimental data on RIM21's dual functionality, implement this systematic approach:

  • Design factorial experiments that independently manipulate pH and salt variables

  • Utilize genetic complementation studies with chimeric proteins containing domains from different species

  • Perform time-resolved analyses to distinguish primary from secondary effects

  • Implement single-cell analyses to identify potential cellular heterogeneity in responses

  • Conduct in vitro binding assays to characterize direct interactions with ions versus protons

  • Use metabolomic profiling to identify metabolic signatures specific to pH versus salt responses

  • Develop dual-reporter systems to simultaneously track pH and salt response pathways

  • Apply mathematical modeling to distinguish correlative from causative relationships

The apparent dual functionality of RIM21 may reflect integrated sensing mechanisms for multiple environmental variables rather than separate regulatory pathways. The experimental evidence showing improved performance at pH 4 with high salt content suggests positive interaction between these response pathways mediated by RIM21 .

How can RIM21 function be leveraged for optimizing D. hansenii's use in industrial bioprocesses?

To optimize D. hansenii's industrial application through RIM21 function, researchers should employ this methodological framework:

  • Screen for natural variants of RIM21 across D. hansenii strains with enhanced performance characteristics

  • Apply directed evolution approaches targeting the RIM21 gene to generate superior variants

  • Develop synthetic promoter systems for controlled expression of RIM21 during bioprocessing

  • Design fed-batch processes that maintain optimal pH and salt conditions for RIM21 activity

  • Implement real-time monitoring systems to adjust process conditions based on RIM21-dependent responses

  • Evaluate RIM21 overexpression in heterologous production systems requiring pH/salt tolerance

  • Assess the impact of RIM21 modification on downstream product recovery and purification

Understanding and manipulating RIM21 function can significantly enhance D. hansenii's applications in industrial bioprocesses, particularly those involving lignocellulosic and non-lignocellulosic feedstocks under challenging pH and salinity conditions .

What experimental design considerations are essential when studying strain-specific differences in RIM21 function?

When investigating strain-specific variations in RIM21 function across D. hansenii isolates, implement this robust experimental design:

  • Include a diverse panel of D. hansenii strains (including the reference strain CBS767)

  • Sequence the RIM21 gene from each strain to identify natural variations

  • Standardize growth conditions and media composition across experiments

  • Employ high-throughput phenotypic assays to characterize responses to varying environmental conditions

  • Normalize experimental data to account for baseline growth differences between strains

  • Conduct reciprocal gene replacement experiments to confirm causative relationships

  • Implement quantitative RT-PCR to measure strain-specific differences in RIM21 expression

  • Use statistical approaches that account for interaction effects between variables

This experimental framework allows for robust comparison across strains while controlling for background genetic effects and environmental variables .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.