Recombinant Debaryomyces hansenii pH-response regulator protein palI/RIM9 (RIM9)

What is the Recombinant Debaryomyces hansenii pH-response regulator protein palI/RIM9 and what is its primary function?

Recombinant Debaryomyces hansenii pH-response regulator protein palI/RIM9 (RIM9) is a full-length protein (365 amino acids) involved in fungal pH sensing pathways. It functions primarily as a plasma membrane-localized protein that aids in the proper localization of other pH sensing components, particularly the putative pH sensor proteins. In the pH response pathway hierarchy, RIM9 appears to play a supportive role similar to its homologs in other fungal species, where it helps maintain proper membrane association of the core sensing machinery . This protein is part of a conserved fungal system that allows adaptation to environmental pH changes, which is crucial for fungal survival in diverse environments.

What is the molecular structure and key domains of the RIM9 protein?

The D. hansenii RIM9 protein consists of 365 amino acids with a full sequence of: "MHKGLLILDLFVSICLTIQLLPIISVPITGKGIGYNLHLSKYGNYTFGVLGLCTSNNICS KPKVGYPPETDAFYSFMDDENGEYPDFAAAELPSRARYVISKLLVVHIVGFCFTTLLFLL SLALTVILWLEESETKVPFKDAVRKKVKIRQNSRNNSSTELTESTSATKMNSLSDEGTVD NERKSKDITPYLNFMLMLSLLSFLSTLLAFLSDILLFIPHLSYLGWLQLCPIILLSTVTS MLCFIKRSISSRKYLNDEYRYENDDMRKSVNVGVLNWKDTDSDDGFYVYTNGFYSNYNND DTPQEGHSHAPELFPANISTHSGWIRHSGHNETGDDVSISSSRDDSYNEHENIQMRLLND HEHIT" . Hydrophobicity analysis suggests it has multiple transmembrane domains, consistent with its predicted membrane localization. The protein likely contains N-terminal hydrophobic regions important for membrane insertion and C-terminal regions that may interact with other components of the pH sensing machinery. Based on homology with other fungal species, RIM9 likely undergoes phosphorylation, although this post-translational modification appears to be non-essential for its basic function .

What are the optimal storage conditions for maintaining recombinant RIM9 protein activity?

For optimal storage of recombinant D. hansenii RIM9 protein, store at -20°C/-80°C upon receipt, with -80°C being preferable for long-term storage . The protein is typically provided in a stabilizing buffer containing 50% glycerol or 6% trehalose at pH 8.0, which helps maintain protein integrity during freeze-thaw cycles . For working stocks, aliquot the protein to avoid repeated freeze-thaw cycles, which significantly reduce activity. Working aliquots can be stored at 4°C for up to one week, but longer storage at this temperature is not recommended . When preparing aliquots, use sterile techniques and pre-chill tubes to minimize protein degradation. Monitoring protein stability over time through activity assays or structural analysis is advisable for critical experiments, as stability can vary between different protein preparations.

What is the recommended reconstitution protocol for lyophilized RIM9 protein?

For optimal reconstitution of lyophilized RIM9 protein, first allow the vial to equilibrate to room temperature (15-25°C) and briefly centrifuge to collect the powder at the bottom of the tube . Reconstitute using deionized sterile water to achieve a final concentration between 0.1-1.0 mg/mL, adding the water slowly while gently rotating the vial to ensure complete dissolution without introducing bubbles . After initial reconstitution, add glycerol to a final concentration of 5-50% (with 50% being commonly recommended) for stability during storage . Once reconstituted, divide into small working aliquots to avoid repeated freeze-thaw cycles, label with the reconstitution date, and store at -20°C or preferably -80°C for long-term storage. For experimental use, thaw aliquots on ice and centrifuge briefly to collect any condensation before opening the tube.

How can I verify the purity and activity of recombinant RIM9 protein before experimental use?

To verify purity and activity of recombinant RIM9 protein, employ a multi-faceted approach. For purity assessment, SDS-PAGE analysis under reducing conditions should show a predominant band at the expected molecular weight (~40-45 kDa including the His-tag), with purity typically >90% . Western blotting using anti-His tag antibodies can confirm the presence of the full-length tagged protein. To assess protein quality, circular dichroism spectroscopy can evaluate secondary structure integrity, while dynamic light scattering can detect aggregation. For functional verification, consider membrane association assays using liposomes or membrane fractions, as RIM9 is predicted to be membrane-associated. Co-immunoprecipitation with known interacting partners (such as Rim21 homologs) can verify binding capability. Additionally, phosphorylation state analysis by mass spectrometry or phospho-specific antibodies may provide insights into post-translational modifications relevant to function, as RIM9 homologs are known to undergo phosphorylation in other fungal species .

How does RIM9 interact with other components of the fungal pH sensing pathway?

RIM9 functions as part of a complex pH sensing machinery in D. hansenii and other fungi. Based on homology with better-characterized systems in Saccharomyces and Aspergillus, RIM9 primarily interacts with the presumed pH sensor protein Rim21/PalH and aids in its proper plasma membrane localization . The interaction likely involves both direct protein-protein contacts and cooperative membrane association. In the pH response pathway, RIM9 works alongside other components including Rim21 (the putative pH sensor), Dfg16 (another membrane component), and Rim8 (which transduces the pH signal and recruits ESCRT machinery) .

A key aspect of the pathway involves the sequential recruitment of components following pH stimulus: upon alkaline pH detection, conformational changes in the sensor protein (Rim21/PalH) lead to signal transduction through Rim8/PalF (which becomes ubiquitinated), ultimately activating the downstream transcription factor Rim101/PacC through proteolytic processing. While RIM9 appears dispensable for signaling in some fungi (phosphorylation is non-essential), it plays an important supportive role in maintaining proper membrane organization of the sensing complex .

What experimental approaches can be used to study RIM9 membrane localization and topology?

To study RIM9 membrane localization and topology, several complementary approaches can be employed:

• Fluorescence microscopy: Generate fluorescent protein fusions (GFP-RIM9) and observe localization in live cells or fixed samples. This can reveal subcellular distribution patterns and potential co-localization with other membrane markers.

• Membrane fractionation: Use ultracentrifugation to separate cellular components and detect RIM9 in membrane fractions using immunoblotting. Differential detergent extraction can further distinguish between different membrane types.

• Protease protection assays: Treat intact cells or isolated membrane fractions with proteases in the presence or absence of membrane-permeabilizing agents to determine which protein regions are accessible, providing insights into topology.

• Chemical modification: Use membrane-impermeable labeling reagents to identify exposed protein domains, comparing intact versus permeabilized cells.

• Computational prediction tools: Combine experimental data with hydrophobicity analysis and transmembrane domain prediction algorithms to create topology models.

Based on studies of homologous proteins, RIM9 likely contains multiple transmembrane domains with specific regions exposed to either the cytoplasm or extracellular environment . The membrane association is critical for its function in stabilizing other components of the pH sensing machinery at the plasma membrane.

What is known about post-translational modifications of RIM9 and their functional significance?

Post-translational modifications (PTMs) of RIM9 have not been extensively characterized specifically in D. hansenii, but insights can be drawn from homologous proteins in other fungi. In Saccharomyces cerevisiae, Rim9 undergoes phosphorylation, though this modification appears to be non-essential for its basic function in pH sensing . The exact phosphorylation sites and responsible kinases remain to be fully elucidated.

By comparison, other components of the pH sensing pathway show more critical PTM dependencies. For instance, Rim8/PalF undergoes ubiquitination which is essential for signal transduction, while Rim21/PalH exhibits both N-glycosylation and phosphorylation . The relative importance of these modifications varies across fungal species, creating an interesting evolutionary pattern.

To experimentally investigate RIM9 PTMs, researchers could employ mass spectrometry-based phosphoproteomics, perform in vitro kinase assays, or create phosphomimetic/phosphodeficient mutants to assess functional consequences. Additionally, examining RIM9 modification states under different pH conditions could reveal regulatory mechanisms that control its activity or localization in response to environmental changes.

How does D. hansenii RIM9 functionally compare with its homologs in model fungi like S. cerevisiae and A. nidulans?

In S. cerevisiae, Rim9 works alongside Dfg16 and Rim21 in the plasma membrane, with phosphorylation occurring but being non-essential for function . The Aspergillus PalI similarly aids in membrane localization, with the interesting requirement for stoichiometrically equivalent expression of PalH and PalI for proper function .

One key difference is observed in protein interactions: while the S. cerevisiae protein appears to have more complex interactions within the sensing complex, the functional dependencies in D. hansenii remain less characterized. Additionally, while all three proteins are involved in alkaline pH sensing, the exact pH range and sensitivity may differ, reflecting the different ecological niches these fungi occupy – with D. hansenii being notable for its halotolerance and ability to grow in high-salt environments, which may influence its pH sensing mechanisms.

What evolutionary insights can be gained from studying RIM9 across diverse fungal species?

Studying RIM9 across diverse fungal species provides valuable evolutionary insights into pH adaptation mechanisms. The most striking evolutionary observation is the complete absence of a Rim9/PalI homologue in Cryptococcus species, indicating alternative pH sensing mechanisms have evolved in this lineage . This suggests that while pH sensing is fundamentally important for fungi, the specific molecular machinery can undergo significant evolutionary rewiring.

These evolutionary patterns correlate with ecological adaptations. D. hansenii, known for its extreme osmotolerance and ability to grow in high salt concentrations, may have evolved specialized pH sensing mechanisms adapted to these challenging environments. Studying these differences can provide insights into how fundamental cellular processes are modified during adaptation to specific ecological niches.

What techniques are most effective for comparing RIM9 function across different fungal species?

For effective cross-species functional comparison of RIM9 proteins, a multi-faceted approach combining the following techniques is recommended:

• Heterologous complementation assays: Express RIM9 from different species in a rim9-deletion mutant of a model organism (e.g., S. cerevisiae) and assess rescue of pH-sensitive phenotypes. This directly tests functional conservation despite sequence divergence.

• Domain swapping experiments: Create chimeric proteins containing domains from RIM9 homologs of different species to identify functionally critical regions and species-specific adaptations.

• Comparative protein localization: Express fluorescently-tagged RIM9 proteins from different species in the same host and compare subcellular localization patterns to identify conserved or divergent targeting mechanisms.

• Interactome mapping: Use techniques like BioID, yeast two-hybrid, or co-immunoprecipitation to compare interaction partners of RIM9 across species, revealing conservation or rewiring of protein-protein interaction networks.

• Comparative transcriptomics: Analyze transcriptional responses to pH changes in wild-type and rim9-deletion strains across multiple fungal species to compare pathway outputs.

• Structural biology approaches: Where feasible, compare protein structures through crystallography or cryo-EM to identify structurally conserved features despite sequence divergence.

• Phylogenetic analysis: Combine functional data with sophisticated phylogenetic methods to trace the evolutionary history of RIM9 and correlate functional changes with speciation events or ecological adaptations.

This integrated approach can reveal both conserved core functions and species-specific adaptations in RIM9 proteins, providing insights into fungal evolution and pH adaptation mechanisms.

How might RIM9 function be exploited for antifungal drug development or biotechnological applications?

The potential for RIM9-targeted antifungal development stems from several key observations. First, pH sensing pathways are crucial for fungal pathogenesis in several species, with disruption of these pathways often attenuating virulence . While D. hansenii itself is rarely pathogenic, the conservation of RIM9 function across fungi makes it relevant for understanding related pathogenic species. Second, the absence of close human homologs reduces the risk of off-target effects, creating a potentially selective target.

For drug development, several approaches could be pursued:

• Small molecules disrupting RIM9 membrane localization

• Peptide inhibitors targeting RIM9 interactions with other pH sensing components

• Compounds that alter RIM9 post-translational modifications

From a biotechnological perspective, engineered RIM9 variants could be developed to create fungi with modified pH responses for industrial applications such as enzyme production or bioremediation. Additionally, the pH sensing pathway components might be repurposed as biosensors for environmental pH monitoring in various biotechnological processes.

The most promising approach would involve high-throughput screening of compound libraries against reconstituted pH sensing complexes, followed by validation in fungal cell models and assessment of effects on pH-dependent gene expression and cellular responses.

What are the methodological challenges in studying membrane-associated proteins like RIM9 and how can they be overcome?

Studying membrane-associated proteins like RIM9 presents several methodological challenges:

• Protein expression and purification: Membrane proteins often express poorly and may aggregate during purification. This can be addressed by optimizing expression systems (using specialized E. coli strains, yeast, or insect cells), employing fusion tags that enhance solubility, and using mild detergents or amphipols for extraction and stabilization .

• Structural characterization: Traditional structural biology techniques are challenging with membrane proteins. Advances in cryo-electron microscopy, NMR methodologies optimized for membrane proteins, and new crystallization approaches using lipidic cubic phases can help overcome these limitations.

• Functional reconstitution: Assessing function often requires reconstitution in a membrane-like environment. Liposomes, nanodiscs, or native membrane vesicles can provide suitable environments for functional studies.

• Interaction studies: Membrane context affects protein-protein interactions. Techniques such as membrane yeast two-hybrid, proximity labeling (BioID, APEX), or fluorescence resonance energy transfer (FRET) can capture these interactions in their native environment.

• Localization and dynamics: Visualizing membrane proteins in living cells requires specialized microscopy approaches. Super-resolution microscopy, single-particle tracking, and fluorescence correlation spectroscopy can provide insights into localization and dynamics at the nanoscale.

For RIM9 specifically, combining biochemical approaches with genetic studies in model fungi and advanced imaging would likely yield the most comprehensive understanding of its function and interactions.

How might environmental factors beyond pH influence RIM9 function and the broader pH sensing pathway?

The function of RIM9 and the broader pH sensing pathway may be significantly modulated by various environmental factors beyond pH itself, creating an integrated sensing network. Key potential environmental influences include:

• Osmotic stress: Given D. hansenii's remarkable osmotolerance, there may be crosstalk between osmotic and pH sensing pathways. High salt conditions might affect RIM9 membrane organization or interactions, potentially altering pathway sensitivity or response dynamics.

• Nutrient availability: Nutrient sensing pathways (particularly nitrogen and carbon sensing) often intersect with pH responses in fungi. RIM9 function might be modulated by nutrient-responsive kinases or through competition for shared pathway components.

• Membrane composition: Changes in membrane lipid composition due to temperature, nutrient availability, or other stresses could affect RIM9 localization and function. Specialized membrane domains (like lipid rafts) might be important for organizing the pH sensing machinery.

• Redox conditions: Oxidative stress might influence RIM9 function through direct modification of sensitive residues or by affecting interacting proteins.

To investigate these potential influences, researchers could employ integrative approaches combining transcriptomics, proteomics, and functional assays under varying environmental conditions. Systems biology approaches could help map the network of interactions between pH sensing and other environmental response pathways, potentially revealing unexpected regulatory connections and adaptation mechanisms that allow fungi like D. hansenii to thrive in challenging environments.

What are the most effective expression systems for producing high-quality recombinant RIM9 protein for research?

For high-quality recombinant RIM9 production, several expression systems offer distinct advantages depending on research needs:

• E. coli-based expression: This is the most commonly used system for RIM9 production as evidenced by commercial preparations . For optimal results, use specialized strains designed for membrane proteins (C41/C43) or those optimized for disulfide bond formation (SHuffle, Origami). Fusion tags like His6 facilitate purification, while solubility-enhancing tags (SUMO, MBP) can improve yield. Expression should be conducted at lower temperatures (16-20°C) with reduced inducer concentrations to minimize inclusion body formation.

• Yeast expression systems: P. pastoris or S. cerevisiae offer proper eukaryotic post-translational modifications and membrane insertion machinery. These systems may produce RIM9 with more native-like modifications and folding, particularly valuable for functional studies where phosphorylation may be relevant .

• Insect cell/baculovirus system: This provides excellent membrane protein expression with eukaryotic modifications. While more resource-intensive, it often yields properly folded membrane proteins at higher quantities than other eukaryotic systems.

For purification, detergent screening is critical, with mild non-ionic detergents (DDM, LMNG) typically preserving membrane protein structure best. For functional studies, consider reconstitution into nanodiscs or liposomes following purification to provide a native-like membrane environment.

How can researchers design effective mutagenesis studies to probe RIM9 structure-function relationships?

To effectively probe RIM9 structure-function relationships through mutagenesis, researchers should adopt a systematic approach:

This systematic approach will yield a comprehensive map of structure-function relationships in RIM9, identifying regions critical for membrane association, protein interactions, and pH response signaling.

What approaches can be used to study the dynamics of RIM9 interactions within the pH sensing complex?

To investigate the dynamics of RIM9 interactions within the pH sensing complex, researchers can employ several cutting-edge approaches:

• Real-time interaction monitoring:

  • Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) between tagged RIM9 and other complex components (particularly Rim21) can reveal interaction dynamics in living cells under varying pH conditions.

  • Split-fluorescent protein complementation assays can visualize interactions as they form in response to pH changes.

• Temporal resolution techniques:

  • Rapid kinetic measurements using stopped-flow fluorescence to capture fast conformational changes or binding events.

  • Single-molecule tracking of fluorescently labeled RIM9 to observe diffusion, clustering, and interaction dynamics at the plasma membrane.

  • Optogenetic tools to precisely control protein activation and observe subsequent complex formation.

• Spatial organization analysis:

  • Super-resolution microscopy (STORM, PALM) to visualize nanoscale organization of the pH sensing complex.

  • Correlative light and electron microscopy to combine dynamic information with ultrastructural context.

  • Proximity labeling approaches (BioID, APEX) with time-course sampling to capture temporal changes in the RIM9 interaction landscape.

• In vitro reconstitution:

  • Purified components reconstituted in model membranes with controlled lipid composition.

  • Surface plasmon resonance or bio-layer interferometry to measure binding kinetics between purified components.

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes and binding interfaces.

• System-wide approaches:

  • Quantitative proteomics with multiple time points after pH shift to map dynamic changes in protein complex composition.

  • Network analysis integrating multiple datasets to model temporal dependencies in complex assembly.

These approaches, especially when used in combination, can provide unprecedented insights into how RIM9 and other components dynamically assemble, communicate, and regulate their activities in response to changing pH conditions.