Recombinant Debaryomyces hansenii Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
PAM17; DEHA2F17710g; Presequence translocated-associated motor subunit PAM17, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-177
Protein Length
Full Length of Mature Protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
PAM17
Target Protein Sequence
SSGKSSLNWVEYLNLKKQNNRLNVASSAFTSLAGAFITLTYLGNIEIQVDKPIMGLDPFM VMGGAVILGGGVGYLFGPFIGTALFSLKNKAAMHQFKIKDQIFLQKIKHHRVDPSSQSFS NPVPDYYGERIYSLNNYKQWLRDCNAFRRKAKEFL
Uniprot No.

Target Background

Function
A component of the PAM complex, essential for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane to the matrix.
Database Links
Protein Families
PAM17 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of PAM17 in mitochondrial protein import?

PAM17 serves as a critical component of the presequence translocase-associated motor (PAM) complex that drives protein translocation into the mitochondrial matrix. As demonstrated through extensive studies, PAM17 is anchored in the inner mitochondrial membrane with exposure to the matrix side . Its primary function involves facilitating the proper organization of the Pam16-Pam18 complex, which regulates the ATPase activity of mtHsp70 at the inner membrane translocation site .

Research has established that mitochondria lacking PAM17 are selectively impaired in matrix protein import, showing significantly reduced import-driving activity of the PAM complex. Specifically, PAM17 promotes the stable association of Pam16-Pam18 with the presequence translocase, which is essential for efficient protein translocation .

Why is Debaryomyces hansenii significant as a model organism for PAM17 studies?

Debaryomyces hansenii represents an exceptional model organism for mitochondrial studies due to several distinctive characteristics:

  • Extreme environmental tolerance - D. hansenii can grow under severe conditions including high salt (up to 4M NaCl) and relatively alkaline pH levels, making it suitable for studying mitochondrial function under stress

  • Metabolic versatility - This yeast possesses high respiratory and low fermentative activity, with the ability to utilize diverse carbon sources, allowing for manipulation of mitochondrial activity through media formulation

  • Genetic tractability - Recent development of transformation systems and gene disruption tools enables genetic manipulation of D. hansenii, facilitating PAM17 studies

  • Evolutionary insights - D. hansenii has been reported to have the highest coding capacity amongst yeasts, providing potential insights into the evolution of mitochondrial import machinery

These characteristics make D. hansenii particularly valuable for studying PAM17 function in environments where mitochondrial proteostasis must adapt to extreme conditions.

What expression systems are most effective for recombinant production of D. hansenii PAM17?

Based on recent advances in D. hansenii molecular biology tools, the following expression systems have demonstrated effectiveness for recombinant protein production:

  • Histidine auxotrophy-based system: Using the DhHIS4 gene as a selectable marker with a histidine auxotrophic recipient strain (such as DBH9) has shown efficient transformation rates for D. hansenii . This approach would be suitable for PAM17 expression with the following methodology:

    • Generate a histidine auxotrophic strain through UV-induced random mutagenesis

    • Clone the PAM17 gene into a vector containing the DhHIS4 selectable marker

    • Transform using optimized electroporation protocols specific for D. hansenii

  • In vivo DNA assembly system: Recent research demonstrates the feasibility of performing in vivo DNA assembly in D. hansenii, where up to three different DNA fragments with 30-bp homologous overlapping overhangs can be co-transformed and correctly assembled . For PAM17 expression, this approach offers:

    • Single-step assembly of promoter-gene-terminator constructs

    • Opportunity to screen various promoters (A. adeninivorans TEF1 promoter shows particularly high expression)

    • Integration of appropriate signal peptides for mitochondrial targeting

  • PCR-based gene targeting: A recently developed method using PCR-based amplification extending heterologous selectable markers with 50 bp flanks allows gene targeting at high efficiency (>75%) . This is particularly valuable for:

    • Integration of PAM17 at its native locus or a safe harbor site

    • Generation of tagged versions for localization and interaction studies

    • Creation of PAM17 mutants for functional analysis

When selecting expression systems, researchers should consider the impact of D. hansenii's high salt adaptation on protein folding and mitochondrial import pathways .

How can researchers effectively confirm mitochondrial localization of recombinant PAM17 in D. hansenii?

Verification of mitochondrial localization requires a multi-faceted approach due to the complex nature of the PAM17 protein:

  • Subcellular fractionation protocol:

    • Isolate D. hansenii mitochondria using differential centrifugation

    • Subject isolated mitochondria to alkaline treatment (pH 11.5)

    • Analyze fractions by Western blotting - PAM17 should fractionate in the membrane pellet like integral proteins (e.g., Tim23, Tim50) while peripheral membrane proteins (e.g., Tim44) should be extracted

  • Import assays with radiolabeled precursors:

    • Synthesize and radiolabel the precursor of PAM17 in rabbit reticulocyte lysate

    • Incubate with isolated mitochondria in the presence of membrane potential (Δψ)

    • Confirm processing to mature-sized form, which is inhibited when Δψ is dissipated

  • Protease protection assays:

    • Subject mitochondria to swelling to open the intermembrane space

    • Verify that PAM17 remains protected against added protease (like matrix-exposed Tim44)

    • Confirm digestion by protease upon sonication of mitochondria to open the matrix

  • Fluorescent protein tagging strategy:

    • Generate C-terminal fluorescent protein fusions (e.g., EGFP) to PAM17

    • Co-localize with established mitochondrial markers (e.g., MitoTracker dyes)

    • Use blind assessment protocols to identify mitochondrial structures and then assess continuity of the PAM17-EGFP signal

These complementary approaches provide robust verification of the inner membrane localization and matrix exposure of PAM17 in D. hansenii.

What purification strategies are optimal for isolating recombinant D. hansenii PAM17 for functional studies?

Purification of recombinant PAM17 requires specialized approaches due to its membrane-embedded nature:

  • Affinity tag selection and placement:

    • C-terminal tagging is preferable as N-terminal contains the targeting sequence

    • Recommended tags include His6 or Protein A for single-step purification

    • For PAM17 specifically, Tim23^ProtA has been successfully used as a co-purification partner

  • Optimized membrane protein extraction:

    • Solubilize isolated mitochondria with mild detergents (digitonin 1% has been effective)

    • Clarify by centrifugation at 20,000×g for 10 minutes at 4°C

    • Isolate the protein using tag-specific affinity chromatography

  • Complex isolation protocol for functional studies:

    • Utilize a preprotein-TOM-TIM23-PAM supercomplex approach:

    • Accumulate a two-membrane-spanning preprotein (b₂(167)Δ-DHFR with methotrexate)

    • Co-purify PAM17 with tagged components (e.g., Tim23 or Tom22)

    • Confirm specific co-purification through Western blotting

  • BN-PAGE analysis strategy:

    • Analyze purified complexes using Blue Native PAGE

    • PAM17 migrates in a distinct BN-PAGE band of approximately 50 kDa

    • This approach allows differentiation from the Pam16-Pam18 complex (~80 kDa)

These techniques enable isolation of PAM17 in forms suitable for both structural and functional characterization.

How does PAM17 contribute to the sequential action mechanism of the presequence translocase-associated motor?

PAM17 and Tim44 function sequentially in protein import into the mitochondrial matrix through a coordinated process involving multiple molecular events:

  • Temporal sequence of action:
    PAM17 is involved in an early stage of protein translocation, facilitating the formation and stabilization of the Pam16-Pam18 complex at the TIM23 translocase. In contrast, Tim44 operates in a later step, directing mtHsp70 to the inner membrane and assisting in substrate handoff .

  • Cooperative function mechanism:
    Genetic and biochemical analyses reveal synthetic interactions between PAM17 and TIM44 genes, indicating their complementary roles in the translocation process. When both components are compromised (as in pam17Δ and tim44 mutants), severe translocation defects occur that exceed the individual defects, demonstrating their functional cooperation .

  • Dynamic protein exchange process:
    Research using radiolabeled components has shown that PAM17, like other motor components, participates in a dynamic replenishment cycle at the TIM23 complex. During active protein translocation, PAM17 recruitment to the complex significantly influences subsequent motor component associations . This recharging process is integral to maintaining motor-driven mitochondrial protein import.

  • Regulatory circuit operation:
    PAM17 influences the organization of the Pam16-Pam18 J-protein complex, which in turn regulates the ATPase activity of mtHsp70. This creates a hierarchical regulatory circuit where PAM17's action precedes and enables the proper function of downstream components .

Experimental evidence from mgr2Δ and tim21Δ mutants reveals that selective defects in PAM17 recharging at the presequence translocase correlate with matrix import phenotypes, confirming its critical role in maintaining the import motor's sequential functionality .

What adaptations might D. hansenii PAM17 possess to function in high-salt environments?

Based on the extreme halotolerance of D. hansenii and the critical role of PAM17 in mitochondrial protein import, several adaptations can be hypothesized:

  • Membrane composition interactions:
    D. hansenii modifies its membrane lipid composition in response to salt stress, increasing the proportion of unsaturated fatty acids and ergosterol. PAM17, as a membrane-anchored protein, likely contains adaptations in its transmembrane domains to function optimally within these altered membrane environments .

  • Protein stability mechanisms:
    High salt environments can significantly affect protein stability and interactions. D. hansenii PAM17 may contain:

    • Increased proportion of acidic amino acids on surface-exposed regions

    • Salt bridges strategically positioned to maintain structural integrity

    • Reduced hydrophobic patches on protein surfaces to prevent aggregation

  • Complex assembly adaptations:
    The Pam16-Pam18 complex organization facilitated by PAM17 may contain modifications to ensure stability under osmotic stress:

    • Enhanced interface interactions between complex components

    • Altered binding kinetics optimized for high-salt conditions

    • Modified association/dissociation rates that accommodate osmotic fluctuations

  • Energy coupling efficiency:
    D. hansenii exhibits high respiratory and low fermentative activity , suggesting adaptations in mitochondrial energy coupling that may extend to the PAM17-dependent import motor:

    • Enhanced coupling between ATP hydrolysis and protein translocation

    • Modified regulatory interactions with other PAM components

    • Adaptations that minimize energy expenditure during protein import under stress

These potential adaptations represent fertile ground for comparative studies between D. hansenii PAM17 and its orthologues in non-halotolerant yeasts.

How do genetic modifications of D. hansenii PAM17 affect mitochondrial function under varying salt conditions?

The effects of PAM17 modifications on mitochondrial function in D. hansenii under different salt concentrations would manifest across several parameters:

  • Import efficiency variations:
    PAM17 mutants likely show salt-dependent defects in mitochondrial protein import. Based on studies in other systems, the following patterns can be anticipated:

    Salt ConcentrationWild-type Import EfficiencyPAM17Δ Import EfficiencyPAM17 Overexpression
    No salt (0M NaCl)Baseline (100%)Reduced (40-60%)Near wild-type
    Moderate (1M NaCl)Enhanced (110-130%)Severely reduced (10-30%)Enhanced (120-140%)
    High (2-4M NaCl)Slightly reduced (80-90%)Severely impaired (<10%)Moderately enhanced (90-120%)

    This pattern reflects D. hansenii's improved performance under moderate salt stress , which would be compromised in PAM17 mutants unable to properly organize the import motor.

  • Respiratory capacity consequences:
    Given D. hansenii's high respiratory activity , PAM17 mutations would significantly affect respiratory metabolism:

    • Decreased cytochrome oxidase activity under salt stress

    • Reduced oxygen consumption rates

    • Impaired growth on non-fermentable carbon sources, especially under high salt

  • Morphological alterations:
    PAM17 deficiency would impact mitochondrial network morphology, with effects intensified under salt stress:

    • Fragmented mitochondrial network instead of tubular structures

    • Abnormal mitochondrial distribution

    • Potential mitochondrial hyperfusion as a compensatory mechanism

  • Transcriptional response patterns:
    PAM17 mutations trigger compensatory transcriptional responses:

    • Upregulation of other import motor components

    • Activation of the unfolded protein response

    • Induction of stress response genes specific to high-salt conditions

These effects would be particularly pronounced at the growth optimum for D. hansenii in pH 4 with high sodium content, where synergistic and protective effects of low pH and high sodium on cell growth have been documented .

How can researchers reconcile conflicting data on PAM17 function between different yeast models?

When addressing discrepancies in PAM17 function data between S. cerevisiae and D. hansenii, researchers should implement a systematic analysis approach:

  • Comparative phenotypic profiling methodology:

    • Generate equivalent PAM17 mutations in both yeast species

    • Assess growth rates under standardized conditions using automated growth curve analysis

    • Measure specific mitochondrial import rates for identical substrate proteins

    • Quantify the data using DMfit software with Baranyi and Roberts model fitting (R² > 0.9)

  • Structural-functional correlation framework:

    • Determine whether functional differences correlate with structural variations

    • Analyze transmembrane segment hydrophobicity using prediction algorithms

    • Create chimeric constructs swapping domains between species to identify critical regions

    • Quantify protein-protein interaction strengths using techniques like microscale thermophoresis

  • Environmental response mapping:

    • Test PAM17 function across a gradient of environmental conditions (salt, pH, temperature)

    • Generate heat maps showing functional parameters against environmental variables

    • Identify condition-specific functional divergence points

    • Apply principal component analysis to distinguish species-specific from condition-specific effects

  • Evolution-informed interpretation:
    When evaluating contradictory results, consider evolutionary context:

    • D. hansenii's adaptation to high-salt environments may have selected for PAM17 variants with altered function

    • Higher respiratory capacity in D. hansenii may impose different constraints on mitochondrial import

    • Genome duplication history differences between the species may affect genetic redundancy and functional requirements

This systematic approach enables reconciliation of apparently conflicting data by identifying context-dependent functional variations rather than true contradictions.

What quality control measurements are essential when assessing recombinant D. hansenii PAM17 activity?

Rigorous quality control is essential for accurate assessment of recombinant PAM17 activity:

  • Protein integrity verification:

    • Confirm correct processing of the presequence using N-terminal sequencing

    • Verify membrane integration through alkaline extraction (pH 11.5)

    • Assess oligomeric state using BN-PAGE (expected ~50kDa band)

    • Validate protein folding through limited proteolysis patterns

  • Functional activity assays:

    • Measure PAM-dependent import using the Δψ-independent motor activity assay

    • Quantify using the protease resistance of intermediate-sized b₂(220)-DHFR

    • Compare activity to internal controls (wild-type vs. pam17Δ mitochondria)

    • Express results as percentage of protease-protected intermediate form

  • Complex formation analysis:

    • Assess Pam16-Pam18 complex stability using co-immunoprecipitation

    • Quantify complex association with TIM23 using tagged Tim23 pull-down

    • Measure recovery efficiency of Pam16-Pam18 with tagged Tim23

    • Standardize using multiple internal controls (Tim44, mtHsp70)

  • Statistical validation requirements:

    • Perform minimum of three biological replicates with technical triplicates

    • Apply appropriate statistical tests (ANOVA with post-hoc analysis)

    • Establish significance threshold (p < 0.05)

    • Include power analysis to ensure adequate sample sizes

These quality control measures ensure that observed phenotypes are specifically attributable to PAM17 function rather than experimental artifacts.

How should researchers evaluate the impact of D. hansenii PAM17 mutations on mitochondrial protein import efficiency?

A comprehensive evaluation of PAM17 mutations requires multi-level analysis:

  • Quantitative import assay protocol:

    • Generate radiolabeled mitochondrial precursor proteins in vitro

    • Incubate with isolated mitochondria from wild-type and mutant strains

    • Measure import kinetics at multiple time points (typically 5, 10, 20, 30 minutes)

    • Quantify using phosphorimaging and express as percentage of input precursor

  • Substrate-specific effects characterization:
    Different substrates may show variable dependence on PAM17, requiring systematic testing:

    Substrate CategoryExample ProteinsExpected Impact in PAM17 MutantsControl Measurements
    Matrix proteinsSu9-DHFR, Atp2Severely impaired (60-90% reduction)Tim23 complex integrity
    Inner membrane proteins with stop-transfer signalCytb₂-DHFRMinimally affected (0-20% reduction)Membrane potential integrity
    Laterally inserted proteinsTim23, Tim17Variably affected (20-40% reduction)TOM complex function
  • In vivo vs. in vitro correlation assessment:

    • Monitor steady-state levels of mitochondrial proteins in vivo

    • Compare with in organello import rates

    • Assess mitochondrial function using oxygen consumption measurements

    • Correlate protein levels with functional parameters

  • Structure-function relationship mapping:

    • Utilize site-directed mutagenesis to create defined PAM17 variants

    • Target conserved residues identified through sequence alignment

    • Test both conservative and non-conservative substitutions

    • Correlate functional defects with structural features

This multi-level approach provides a comprehensive understanding of how specific PAM17 mutations affect different aspects of mitochondrial protein import.

What potential biotechnological applications might emerge from research on D. hansenii PAM17?

Research on D. hansenii PAM17 opens several promising biotechnological avenues:

  • Stress-resistant protein production systems:
    Understanding how D. hansenii's mitochondrial import system functions under extreme conditions could enable development of:

    • Salt-resistant protein expression platforms for industrial enzymes

    • Bioprocesses utilizing lignocellulosic biomass and non-lignocellulosic feedstocks under high-salt conditions

    • Production systems for proteins that are difficult to express in conventional hosts

  • Biocontrol applications in food preservation:
    D. hansenii strains exhibit antagonistic effects against contaminating molds in the dairy industry . Manipulation of PAM17 could potentially:

    • Enhance production of antifungal volatile compounds like 3-methylbutanoic acid, 2-phenylethanol, and acetic acid

    • Improve stress resistance of biocontrol strains

    • Enable metabolic engineering for enhanced production of specific protective compounds

  • Enhanced mitochondrial targeting systems:
    Insights from D. hansenii PAM17 could inform the design of:

    • Improved mitochondrial targeting sequences for therapeutic proteins

    • Novel approaches for allotopic expression of mitochondrial genes

    • Strategies to overcome hydrophobicity barriers in mitochondrial protein import

  • Synthetic biology applications:
    The unique properties of D. hansenii PAM17 could contribute to:

    • Design of synthetic organelles with enhanced protein import capabilities

    • Creation of minimal mitochondrial protein import systems

    • Development of stress-resistant cellular systems for bioremediation

These applications leverage the unique adaptations of D. hansenii to extreme environments and could significantly expand biotechnological capabilities in challenging conditions.

How might CRISPR-Cas9 gene editing techniques be optimized for studying PAM17 function in D. hansenii?

Optimizing CRISPR-Cas9 for D. hansenii PAM17 research requires specific adaptations:

  • D. hansenii-specific CRISPR systems development:
    Recent advances in D. hansenii gene editing technologies can be further refined for PAM17 studies:

    • Optimize codon usage for Cas9 expression in D. hansenii

    • Develop RNA polymerase III promoters specific to D. hansenii for sgRNA expression

    • Create libraries of validated guide RNAs targeting PAM17 and associated genes

    • Engineer Cas9 variants with enhanced activity in high-salt environments

  • Homology-directed repair enhancement strategies:
    Efficient gene targeting requires optimization of homologous recombination:

    • Utilize PCR-based amplification with 50 bp homology arms for high-efficiency targeting (>75%)

    • Develop selectable marker cassettes consisting exclusively of heterologous DNA sequences

    • Implement in vivo DNA assembly methods for complex genetic constructs

    • Establish safe harbor sites for controlled expression of PAM17 variants

  • Multiplexed editing approaches:
    Simultaneous modification of multiple PAM components:

    • Design single vector systems expressing multiple sgRNAs

    • Establish methods for sequential editing of PAM17 and interacting proteins

    • Optimize transformation protocols for delivery of multiple DNA constructs

    • Develop screening strategies for identifying correctly edited clones

  • Inducible and tissue-specific editing systems:
    For detailed functional studies:

    • Create inducible Cas9 expression systems responsive to non-fermentable carbon sources

    • Develop methods for targeting Cas9 to mitochondria for organelle-specific genome editing

    • Establish reversible PAM17 disruption systems using degron-based approaches

    • Implement CRISPRi systems for tunable repression of PAM17 expression

These optimizations would significantly enhance the precision and efficiency of PAM17 functional studies in D. hansenii.

What insights could comparative studies of PAM17 across diverse yeast species provide about mitochondrial evolution?

Comparative PAM17 studies across yeast species could illuminate fundamental aspects of mitochondrial evolution:

  • Evolutionary adaptation of import motors:
    Comparison of PAM17 sequences and functions across species with different ecological niches would reveal:

    • Correlation between PAM17 structure and environmental adaptation

    • Identification of conserved functional domains versus variable adaptive regions

    • Understanding of how mitochondrial import motors adapted to diverse metabolic strategies

  • Gene transfer mechanisms and barriers:
    Analysis of PAM17 across species could provide insights into:

    • Why some mitochondrial genes remain resistant to transfer to the nucleus

    • The role of protein hydrophobicity in limiting gene relocation

    • How protein-protein interactions constrain evolutionary trajectories

    • Potential mechanisms for overcoming these barriers, as demonstrated by ATP9 gene relocation experiments

  • Coevolution of import machinery components:
    Examining PAM17 alongside other import components would reveal:

    • Patterns of coordinated evolution between interacting proteins

    • Compensatory mutations that maintain functional interactions

    • Lineage-specific adaptations that reflect metabolic specialization

    • Correlation between PAM17 evolution and mitochondrial genome reduction

  • Ancient diversification events:
    Phylogenetic analysis of PAM17 across diverse yeast species could:

    • Reconstruct the evolutionary history of mitochondrial import mechanisms

    • Identify potential horizontal gene transfer events

    • Reveal ancient duplications and subfunctionalization

    • Provide molecular clock data for dating key evolutionary transitions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.