Recombinant Debaryomyces hansenii Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Debaryomyces hansenii Probable Endonuclease LCL3 (LCL3)

Recombinant Debaryomyces hansenii Probable endonuclease LCL3 (LCL3) is a protein expressed in Debaryomyces hansenii, a halotolerant yeast with increasing applications in fundamental and applied research . Endonucleases like LCL3 are enzymes that cleave phosphodiester bonds within a nucleic acid sequence . The "probable" designation suggests that while the protein exhibits endonuclease activity, its precise function and specificity may require further characterization .

Debaryomyces hansenii: Properties and Significance

Debaryomyces hansenii is drawing increasing attention for both basic and industrial research because of its remarkable stress tolerance .

Key characteristics of Debaryomyces hansenii:

  • Stress Tolerance This yeast can withstand high salt concentrations, oxidative stress, and other harsh environmental conditions .

  • Metabolic Versatility D. hansenii can use various carbon sources, produce valuable metabolites such as glycerol, and accumulate significant amounts of lipids .

  • Genetic Tools Various genetic tools, including autonomously replicating sequences (ARS) and plasmids, have been developed for D. hansenii, facilitating genetic engineering and functional studies .

LCL3 Endonuclease: Characteristics and Features

FeatureDescription
Recommended NameProbable endonuclease LCL3
EC Number3.1.-.-
OrganismDebaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968)
UniProt No.Q6BSY9
Amino Acid Range1-235 (Full Length)
SequenceMPPIPSEPENISLIHPKVLLLSAGVTTSLFLSYKFYKRYVRRIRNYLDLTPEILDRQTPL YGRVTRVGDGDNFRFYHTPGGILFGWGWLRHVPTKRQELKDETLMVRLCGVDAPERAHWG KPAQPYSEEALAWLKNYIFGRNVVVTPYSIDQYKRLVGRAQVWKWTGKKDISAEmLRNGL GVVYEGKIGAEFGDNESWYRKLEARAKWLRRGLWSLGSSMTTPGEFKKVHYRGDS

Production and Availability

Recombinant LCL3 endonuclease can be produced in E. coli using recombinant DNA technology . The recombinant protein typically includes a His-tag for purification purposes .

Potential Applications and Research Directions

Given its nature as a probable endonuclease, LCL3 may play a crucial role in DNA repair, replication, or other nucleic acid-related processes within D. hansenii . Further research is needed to elucidate its specific function, regulation, and potential applications.

Potential research areas include:

  • Enzyme Activity and Specificity: Detailed biochemical assays to determine the enzyme's activity, substrate specificity, and optimal reaction conditions .

  • Structural Analysis: Determining the 3D structure of the protein to understand its mechanism of action and potential interactions with other molecules.

  • Role in Stress Response: Investigating the role of LCL3 in the stress response of D. hansenii, particularly in relation to its halotolerance and osmotolerance .

  • Genetic Engineering: Utilizing LCL3 as a tool for genetic engineering in D. hansenii or other organisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
LCL3; DEHA2D04950g; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
LCL3
Target Protein Sequence
MPPIPSEPENISLIHPKVLLLSAGVTTSLFLSYKFYKRYVRRIRNYLDLTPEILDRQTPL YGRVTRVGDGDNFRFYHTPGGILFGWGWLRHVPTKRQELKDETLMVRLCGVDAPERAHWG KPAQPYSEEALAWLKNYIFGRNVVVTPYSIDQYKRLVGRAQVWKWTGKKDISAEMLRNGL GVVYEGKIGAEFGDNESWYRKLEARAKWLRRGLWSLGSSMTTPGEFKKVHYRGDS
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.