Recombinant Debaryomyces hansenii Protein SYM1 (SYM1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SYM1; DEHA2F01760g; Protein SYM1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
SYM1
Target Protein Sequence
MASIYQKYSQLIAKRPLITNIITTGFLFGSGDYLAQTLYPSSSKYDYKRTLRATFYGSII FAPIGDKWYRLLHKINFPFPKTKVSPTVSKVLNTLTKVGVDQLVFAPFIGIPLYYSVMSV LEFHDNPLQVAREKLHAHWFNTLKTNWVVWPTFQLFNFALIPVQFRLLVVNIFSIGWNCY LSSVLNHKHDFLIENITDVDKDEILI
Uniprot No.

Target Background

Function
This protein may be involved in cellular stress responses. It is required for maintaining the integrity and stability of mitochondrial DNA (mtDNA).
Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii and why is it used in SYM1 protein research?

Debaryomyces hansenii (also known as Candida famata) is a halotolerant, osmotolerant yeast species in the Saccharomycetaceae family . It has become valuable in research settings for several key reasons:

  • It possesses exceptional tolerance to high salt concentrations (up to 25% NaCl) and can survive in pH ranges between 3-10

  • Its genomic sequence is well-characterized, facilitating genetic manipulation

  • It serves as an excellent model organism for studying mitochondrial proteins, particularly SYM1, which is homologous to human MPV17

  • Its natural resistance to environmental stressors makes it suitable for various experimental conditions

The yeast's ability to grow in challenging environments while maintaining protein expression makes it particularly useful for recombinant protein production systems where environmental stress might otherwise compromise protein stability or yield .

How does SYM1 protein function at the cellular level in D. hansenii?

SYM1 protein in D. hansenii primarily functions within mitochondria, where it participates in a high molecular weight complex essential for mitochondrial functionality . Key characteristics include:

  • SYM1 does not require classical N-terminus targeting sequences for mitochondrial import, instead utilizing internal targeting sequences

  • The protein contains multiple transmembrane segments that are crucial for proper assembly into its functional complex

  • It plays a role in maintaining mitochondrial oxidative phosphorylation (OXPHOS) function

  • Deletion of the SYM1 gene (sym1Δ) results in defective OXPHOS phenotype and mitochondrial DNA instability

Studies have shown that the absence of SYM1 can lead to significant mitochondrial dysfunction, emphasizing its importance in maintaining cellular respiration and energy production pathways .

How should I design experiments to study SYM1 protein localization and complex formation?

When investigating SYM1 protein localization and complex formation, consider the following experimental design approach:

  • Define your variables clearly:

    • Independent variable: SYM1 protein variants (wild-type vs. specific mutations)

    • Dependent variables: Protein localization, complex formation, mitochondrial function

    • Control variables: Growth conditions, expression levels, cellular fractionation methods

  • Construct tagged recombinant variants:

    • Include the complete SYM1 gene sequence with natural promoter and terminator

    • Add epitope tags (such as HA) that don't interfere with function or localization

    • Create both wild-type and mutated versions for comparative analysis

  • Implement cellular fractionation protocols:

    • Isolate cytosolic and mitochondrial fractions under conditions where the percentage of petite colonies is comparable between experimental strains

    • Verify fraction purity using established markers (e.g., Por1 for mitochondria, Pgk1 for cytosol)

  • Analyze protein complexes using 2D-BNGE (2D Blue Native Gel Electrophoresis):

    • Extract mitochondrial proteins under native conditions

    • Separate by molecular weight in the first dimension

    • Perform SDS-PAGE in the second dimension

    • Detect target proteins via immunoblotting

This methodological approach allows rigorous examination of both localization and complex formation, providing insights into how mutations might affect protein function at the molecular level .

What control conditions are essential when measuring SYM1 protein stability in recombinant systems?

Control TypePurposeImplementation Method
Positive controlVerify detection system functionalityInclude wild-type SYM1-HA protein sample
Negative controlConfirm antibody specificityInclude sym1Δ strain samples
Loading controlNormalize protein quantificationUse stable mitochondrial proteins (e.g., Por1)
Expression controlVerify similar transcription levelsMeasure mRNA levels of wild-type and mutant variants
Environmental controlsMinimize external variablesMaintain consistent temperature, pH, and growth media composition
Time course controlsAccount for degradation kineticsMeasure protein levels at multiple time points after expression

Additionally, when assessing protein degradation patterns, include overexposure controls during Western blot analysis to identify specific degradation bands, which can provide mechanistic insights into how mutations affect protein stability . For mutations that severely impact protein levels (like G24W), additional controls to distinguish between synthesis defects and stability issues may be necessary .

How can 2D-BNGE analysis be optimized for studying SYM1 complex assembly defects?

2D-BNGE (Two-Dimensional Blue Native Gel Electrophoresis) is a powerful technique for analyzing complex assembly defects in SYM1 protein. To optimize this approach:

  • Sample preparation optimization:

    • Use digitonin (0.5-1.5%) for gentle solubilization that preserves native complexes

    • Maintain consistent protein-to-detergent ratios (typically 1:5 w/w)

    • Keep samples at 4°C throughout preparation to prevent complex dissociation

  • First dimension separation refinement:

    • Utilize gradient gels (3-12% or 4-16%) for optimal complex resolution

    • Include native protein markers to accurately determine complex sizes

    • Run at lower voltage (100V) initially, then increase to 300V for better separation

  • Second dimension considerations:

    • Use 12-15% SDS-PAGE for optimal resolution of SYM1 protein (~22 kDa)

    • Consider tricine-based systems for better separation of smaller proteins

    • Optimize transfer conditions for efficient immunodetection

  • Detection strategy:

    • Employ highly sensitive chemiluminescent detection for low-abundance complexes

    • Adjust exposure times appropriately for different SYM1 variants (longer exposures for less stable variants like G24W)

    • Quantify signals using densitometry with appropriate normalization

This optimized approach enables detection of subtle assembly defects, revealing how different mutations affect complex formation. For example, studies have shown that mutations in SYM1 can result in shifts toward lower molecular weight complexes, indicating incomplete assembly or reduced stability of the full complex .

What analytical challenges arise when comparing multiple SYM1 mutant variants, and how can they be addressed?

Comparing multiple SYM1 mutant variants presents several analytical challenges that require careful methodological approaches:

By addressing these challenges methodically, researchers can generate comprehensive comparative analyses of how different mutations impact SYM1 protein biology and function.

How does SYM1 serve as a model for human MPV17-related disorders?

SYM1 provides a valuable model for studying human MPV17-related disorders due to several key similarities and experimental advantages:

  • Structural and functional homology:

    • SYM1 is the yeast ortholog of human MPV17, with conserved transmembrane domains

    • Both proteins localize to the inner mitochondrial membrane

    • Both participate in high molecular weight complexes and influence mitochondrial function

  • Pathogenic mutation modeling:

    • Mutations in human MPV17 associated with mitochondrial DNA depletion syndrome (MDDS) can be recreated in equivalent positions in SYM1

    • The yeast system allows rapid assessment of how these mutations affect protein stability, localization, and complex formation

  • Phenotypic similarities:

    • Loss of SYM1 in yeast and MPV17 in humans both lead to mitochondrial dysfunction

    • Both result in mitochondrial DNA abnormalities and oxidative phosphorylation defects

  • Experimental advantages:

    • Yeast allows high-throughput mutation screening not possible in human cells

    • Easier genetic manipulation and rapid generation time

    • Well-established mitochondrial isolation and analysis protocols

The correlation between SYM1 mutation effects in yeast and MPV17 mutations in human disease has been demonstrated in multiple studies. For example, the human G24W mutation in MPV17 (modeled as G24W in SYM1) causes severe protein instability in both systems, correlating with more severe clinical presentations .

What methodological approaches best demonstrate the translational relevance of SYM1 findings to human disease?

To establish translational relevance between SYM1 research findings and human MPV17-related disorders, consider implementing these methodological approaches:

  • Parallel mutation analysis:

    • Generate equivalent mutations in both yeast SYM1 and human MPV17

    • Express human MPV17 variants in sym1Δ yeast to assess functional complementation

    • Evaluate whether the molecular effects of mutations (on stability, localization, etc.) are conserved across species

  • Functional readout correlation:

    • Measure standardized parameters in both systems (e.g., mitochondrial membrane potential, ROS production)

    • Compare biochemical phenotypes with clinical severity in patients

    • Create severity indices that integrate multiple parameters

  • Rescue experiments:

    • Test whether human MPV17 can rescue sym1Δ phenotypes

    • Assess whether pharmacological interventions that improve SYM1 mutant function in yeast also benefit human cells with MPV17 mutations

    • Evaluate structure-function relationships through domain-swapping experiments

  • Multi-system validation:

    • Confirm key findings in multiple model systems (yeast, patient fibroblasts, animal models)

    • Use consistent methodological approaches across systems

    • Develop quantitative metrics for cross-species comparison

For example, research has shown that the molecular mechanisms underlying pathology in SYM1 G24W mutants (protein instability and reduced complex formation) parallel those observed in patient cells with the equivalent MPV17 mutation, validating the yeast model's relevance to human disease .

How can single-subject experimental designs (SSEDs) be applied to study SYM1 function in time-course experiments?

Single-subject experimental designs (SSEDs) offer unique advantages for studying dynamic aspects of SYM1 function through carefully structured time-course experiments:

  • Withdrawal design application:

    • Baseline: Measure SYM1 complex formation and mitochondrial function in normal conditions

    • Intervention: Introduce stress conditions (oxidative stress, osmotic shock)

    • Withdrawal: Return to normal conditions

    • Reinstatement: Reintroduce stress conditions

  • Alternating treatment design methodology:

    • Rapidly alternate between different environmental conditions

    • Measure real-time changes in SYM1 complex dynamics

    • Determine the reversibility and adaptation characteristics of SYM1 function

  • Multiple baseline design approach:

    • Introduce mutations or treatments at different time points

    • Track changes in multiple parameters (complex formation, mtDNA stability, respiration)

    • Establish temporal relationships between primary effects and secondary consequences

When implementing SSEDs for SYM1 research, it's crucial to assess whether the observed effects are truly reversible. For instance, some mitochondrial phenotypes may not return to baseline after stress withdrawal, limiting the applicability of certain SSED approaches . Additionally, high-resolution temporal sampling is essential for capturing transient states in SYM1 complex assembly and function.

What are the optimal osmotic stress conditions for studying SYM1 function in D. hansenii, and how should experiments be designed?

D. hansenii's exceptional halotolerance makes it an ideal model for studying how SYM1 functions under osmotic stress conditions. The optimal experimental design should include:

  • Precise osmotic gradient determination:

    • Range: Test NaCl concentrations from 0% to 25% (the upper limit of D. hansenii tolerance)

    • Increments: Use 5% increments for broad assessment, 1% increments for refined analysis

    • Alternative osmolytes: Compare NaCl with KCl (up to 18%) and glycerol (up to 18%) effects

  • Growth condition standardization:

    • Media: Use defined minimal media to eliminate confounding nutrients

    • Temperature: Maintain at optimal growth temperature (25°C)

    • pH control: Buffer media to prevent pH shifts during growth

  • Adaptation period considerations:

    • Pre-adaptation: Determine if prior exposure to moderate salt affects subsequent high-salt tolerance

    • Time course: Measure responses at multiple time points (immediate, 2h, 6h, 24h, 48h)

    • Generational effects: Assess whether adaptation is transient or heritable

  • Measurable parameters:

    • SYM1 complex integrity via 2D-BNGE analysis

    • Mitochondrial function (respiration rate, membrane potential)

    • Cellular growth rates and morphology

    • SYM1 expression levels and subcellular distribution

NaCl ConcentrationExpected Effect on SYM1 ComplexExpected Growth Response
0-1%Baseline complex formationNormal growth
1-10%Enhanced complex stabilityGrowth stimulation
10-20%Complex remodelingAdaptive growth
20-25%Stress-induced complex destabilizationGrowth limitation

D. hansenii's growth rate actually increases in solutions with ≥1M NaCl or KCl, a feature that can be leveraged to study how SYM1 contributes to this adaptive response . Comparison between wild-type and sym1Δ strains across this osmotic gradient can reveal the specific contributions of SYM1 to osmoadaptation mechanisms.

How can researchers address discrepancies between in vitro and in vivo findings when studying SYM1 complex formation?

When encountering discrepancies between in vitro and in vivo observations of SYM1 complex formation, consider these methodological approaches:

  • Protein extraction condition optimization:

    • Test multiple detergent types and concentrations (digitonin, DDM, Triton X-100)

    • Evaluate how extraction conditions might selectively solubilize different complex states

    • Compare rapid isolation methods with more gentle, time-consuming approaches

  • Native state preservation strategies:

    • Implement crosslinking before extraction to "freeze" in vivo interactions

    • Use ratiometric fluorescent protein tagging to measure interactions in living cells

    • Develop complementary techniques like proximity labeling to validate interactions

  • Reconciliation approaches:

    • Map specific discrepancies to methodological differences

    • Determine which condition better represents physiological reality through functional correlations

    • Develop hybrid approaches that combine strengths of multiple methods

  • Systematic validation:

    • Design experiments that specifically test whether observed differences are technical artifacts or biologically meaningful

    • Use orthogonal techniques to confirm key findings

    • Implement controls that can distinguish between these possibilities

For example, if a mutation appears to completely disrupt SYM1 complex formation in vitro but shows partial function in vivo, experiments could be designed to test whether the complex requires additional cellular factors absent in the in vitro system, or whether the extraction process disrupts more fragile mutant complexes that can still form in the cellular environment .

What are the most effective strategies for distinguishing between primary effects of SYM1 mutations and secondary consequences?

Distinguishing primary effects of SYM1 mutations from secondary consequences requires sophisticated experimental strategies:

  • Temporal resolution studies:

    • Implement time-course experiments with high-resolution sampling

    • Identify the earliest detectable changes following mutation introduction

    • Track the sequential appearance of phenotypes to establish cause-effect relationships

  • Genetic suppressor screening:

    • Identify secondary mutations that rescue SYM1 mutant phenotypes

    • Determine whether suppressors act by restoring the primary function or by compensating through alternate pathways

    • Map genetic interactions to build functional networks

  • Targeted complementation approaches:

    • Develop domain-specific complementation constructs

    • Test whether providing specific SYM1 functions can rescue distinct aspects of the mutant phenotype

    • Use this approach to map function-phenotype relationships

  • Multi-level system analysis:

    • Integrate data from protein biochemistry, transcriptomics, and functional assays

    • Build models of primary and secondary effects

    • Test model predictions through targeted interventions

This approach has been successfully applied to distinguish between direct effects of mutations on SYM1 protein stability versus secondary consequences for complex assembly. For example, the G24W mutation primarily affects protein stability, with complex assembly defects being a secondary consequence of reduced protein levels, while other mutations (like R51W) show complex assembly defects even with near-normal protein levels .

What novel experimental approaches could advance our understanding of SYM1 function in mitochondrial physiology?

Emerging experimental approaches that could significantly advance SYM1 research include:

  • Cryo-electron microscopy applications:

    • Determine the high-resolution structure of SYM1 complexes

    • Map mutation sites to functional domains

    • Visualize conformational changes under different conditions

  • In situ proximity labeling techniques:

    • Apply BioID or APEX2 technology to map the SYM1 interactome

    • Identify condition-specific interaction partners

    • Compare interactomes between wild-type and mutant variants

  • Single-molecule tracking methodologies:

    • Visualize SYM1 dynamics in living cells

    • Measure complex assembly/disassembly kinetics

    • Determine how mutations affect molecular mobility and interaction dynamics

  • Integrative multi-omics approaches:

    • Combine proteomics, lipidomics, and metabolomics data

    • Create comprehensive models of SYM1's role in mitochondrial homeostasis

    • Identify system-level consequences of SYM1 dysfunction

  • CRISPR-based screening platforms:

    • Perform genome-wide screens for genetic modifiers of SYM1 function

    • Identify novel components of SYM1-dependent pathways

    • Discover potential therapeutic targets for related human disorders

These advanced approaches would help address critical knowledge gaps, particularly regarding the molecular mechanism through which SYM1 influences mitochondrial DNA stability and oxidative phosphorylation, potentially revealing new therapeutic avenues for human MPV17-related disorders .

How might D. hansenii's extreme halotolerance inform our understanding of SYM1 function in stress response pathways?

D. hansenii's exceptional ability to thrive in high-salt environments offers unique insights into how SYM1 may function in stress response pathways:

  • Comparative genomic approaches:

    • Compare SYM1 sequences across yeast species with varying halotolerance

    • Identify species-specific adaptations in SYM1 structure

    • Determine whether these adaptations correlate with osmotolerance capabilities

  • Stress pathway integration studies:

    • Map SYM1's position in known osmotic stress response pathways

    • Determine whether SYM1 functions upstream (as a sensor) or downstream (as an effector)

    • Identify stress-specific post-translational modifications of SYM1

  • Membrane dynamics investigations:

    • Analyze how SYM1 influences mitochondrial membrane composition under osmotic stress

    • Determine whether SYM1 complexes serve as organizing centers for specialized membrane domains

    • Investigate potential roles in ion transport or membrane potential maintenance

  • Cross-species functional complementation:

    • Express SYM1 from halotolerant D. hansenii in less tolerant yeast species

    • Determine whether this confers enhanced osmotolerance

    • Identify the specific molecular features responsible for any enhanced function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.