Recombinant Debaryomyces hansenii Protein YOP1 (YOP1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant YOP1

Recombinant Debaryomyces hansenii Protein YOP1 is a bioengineered version of the yeast’s native YOP1 protein, optimized for laboratory or industrial applications. Expressed in E. coli, this His-tagged protein spans the full-length sequence (1–177 amino acids) and is characterized by high purity (>90%) and stability under specific storage conditions .

Applications in Protein Production

Debaryomyces hansenii is renowned for its halotolerance and ability to produce recombinant proteins in high-salt environments. Key findings include:

  • Secretion Efficiency: D. hansenii can secrete YFP (as a model protein) using the α-mating factor (MF) signal peptide from S. cerevisiae, achieving stability in 1 M NaCl conditions .

  • CRISPR/Cas9 Engineering: Tools for in vivo DNA assembly enable rapid strain optimization for promoter/terminator screening, enhancing recombinant protein yields .

Production Limitations

  • Expression Host Dependency: Recombinant YOP1 is produced in E. coli, which may introduce structural or functional differences compared to native D. hansenii expression systems .

  • Stability Concerns: Repeated freeze-thaw cycles degrade recombinant YOP1, necessitating strict storage protocols (-20°C/-80°C with glycerol) .

Comparative Analysis of D. hansenii Protein Production

ParameterD. hansenii (YFP/YOP1)S. cerevisiae (YFP)
Salt ToleranceGrows in 1 M NaCl media Inhibited by high salt
Secretion EfficiencyStable secretion in salty by-products Requires freshwater supplementation
Genetic ToolsCRISPR/Cas9, in vivo DNA assembly Well-established toolboxes

Potential Applications

  • Biotechnology: YOP1’s role in organelle dynamics could be leveraged to engineer strains with enhanced metabolic flux for biofuel or polyol production .

  • Structural Studies: High-resolution imaging of YOP1 in D. hansenii may reveal insights into halotolerant protein folding .

Knowledge Gaps

  • Functional Characterization: Direct evidence linking recombinant YOP1 to specific biochemical pathways remains sparse.

  • Industrial Scalability: Open cultivations of D. hansenii in non-sterile environments (e.g., dairy by-products) require validation for large-scale YOP1 production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipments, as additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YOP1; DEHA2B11264g; Protein YOP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
YOP1
Target Protein Sequence
MSYQNQAKSFLSTIDEKTKDLQILRQFELKTGLPRSYAILGGFGLYFVLIFLNIGGVGQL LSNIAGLVIPGYFSLLALESTTTSDDTQLLTYWVVFATFNVVEFWSKAILYWIPFYYLFK TVFLVYIGIPSTGGAVTVYNAAIKPFSRRYIVNNKKFAQDINNAAQGVSSSVELLAS
Uniprot No.

Target Background

Function
Involved in membrane/vesicle trafficking.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Debaryomyces hansenii Protein YOP1?

YOP1 (YIP One Partner) in D. hansenii is a membrane protein involved in endoplasmic reticulum morphology regulation. Like its homologs in other yeasts, it belongs to the Reticulon-like protein family that maintains the tubular structure of the ER network. In D. hansenii, YOP1 may play additional roles in stress adaptation, particularly in the context of the organism's exceptional halotolerance. The protein contains hydrophobic regions that form hairpin structures within the ER membrane, helping to induce and stabilize membrane curvature essential for proper organelle morphology and function.

How does D. hansenii's halotolerance affect recombinant protein expression?

D. hansenii exhibits remarkable halotolerance, capable of growing in environments with up to 4.11 M sodium, though growth inhibition occurs at concentrations exceeding 2M NaCl . This halotolerance creates unique advantages for recombinant protein expression under high-salt conditions that might inhibit other expression systems.

Research has shown that the presence of 1M NaCl actually improves D. hansenii's performance under various abiotic stresses . This salt-induced protective effect extends to conditions including extreme pH, oxidative stress, and temperature variations . For recombinant protein expression, this means:

  • Enhanced stability of expression systems under stress conditions

  • Potential for higher protein yields when expression is conducted in salt-containing media

  • Improved cell viability during long-term expression protocols

These characteristics make D. hansenii particularly valuable for expressing proteins that might be difficult to produce in conventional systems due to toxicity or stress-related issues.

What genetic tools are available for YOP1 manipulation in D. hansenii?

Recent advances have significantly improved genetic manipulation capabilities in D. hansenii. A PCR-based gene targeting system now allows for efficient homologous recombination in wild-type isolates without requiring auxotrophic markers . This method uses:

  • PCR amplification with 50 bp flanking regions homologous to the target site

  • Heterologous selectable markers conferring Hygromycin B or G418 resistance

  • Integration of constructs through homologous recombination at high frequency (>75%)

For YOP1 manipulation specifically, researchers can use these tools to:

  • Disrupt the endogenous YOP1 gene to study loss-of-function phenotypes

  • Introduce modified versions of YOP1 (tagged, mutated, etc.) at safe harbor sites

  • Express heterologous YOP1 variants from other organisms to study functional conservation

These methods have overcome previous limitations in D. hansenii genetic engineering and now make targeted manipulation of genes like YOP1 economical and readily achievable.

What experimental approaches best identify YOP1 post-translational modifications?

Identifying post-translational modifications (PTMs) of YOP1 in D. hansenii requires specialized approaches that account for this yeast's unique physiology. Based on recently developed methods for D. hansenii:

  • Phosphoproteomic analysis: Cell samples from D. hansenii grown under varying salt conditions (NaCl vs KCl) have been successfully analyzed for phosphoproteome changes . For YOP1-specific analysis:

    • Immunoprecipitate YOP1 using epitope tags introduced through the PCR-based gene targeting system

    • Perform LC-MS/MS analysis of purified protein

    • Compare phosphorylation patterns between normal and stress conditions

  • Site-directed mutagenesis: After identifying potential modification sites:

    • Generate mutant versions of YOP1 using the PCR-based integration system

    • Introduce alanine substitutions at potential phosphorylation sites

    • Analyze resulting phenotypes in response to salt and other stresses

  • Comparative analysis: The DebaryOmics study provides a valuable framework for comparing PTMs across different growth conditions , which could be extended to YOP1-specific analyses.

What are the challenges in purifying recombinant D. hansenii YOP1?

Purifying membrane proteins like YOP1 from D. hansenii presents several technical challenges:

  • Membrane extraction efficiency:

    • D. hansenii's robust cell wall requires optimized lysis conditions

    • Salt concentration during extraction must be carefully controlled given D. hansenii's halophilic nature

  • Detergent selection:

    • Conventional detergents may not optimize extraction from D. hansenii's membranes

    • Testing a panel of detergents (DDM, LDAO, etc.) with varying concentrations is essential

  • Salt-dependent structural changes:

    • YOP1 structure and stability may vary with salt concentration

    • Purification buffers may require salt optimization different from conventional protocols

  • Heterologous expression considerations:

    • If expressing D. hansenii YOP1 in other systems, codon optimization may be necessary

    • Expression conditions should mimic D. hansenii's preferred growth environment (pH, salt)

Experimental data comparing YOP1 purification yields under different conditions would be valuable for the research community but is not provided in the current literature.

How can one optimize PCR-based gene targeting for YOP1 in D. hansenii?

Based on recently developed methods , optimizing PCR-based gene targeting for YOP1 manipulation requires:

  • Primer design strategy:

    • Include 50 bp homology arms flanking the target site in the YOP1 locus

    • Ensure primers have appropriate melting temperatures for D. hansenii's GC content

  • Selectable marker selection:

    • Use heterologous markers conferring Hygromycin B or G418 resistance

    • Position marker cassette to avoid disrupting essential YOP1 domains

  • Transformation protocol:

    • Confirmed high efficiency (>75%) transformation through homologous recombination

    • Consider strain-specific variation in transformation efficiency

  • Verification strategy:

    • Design PCR verification primers outside the integration region

    • Sequence integration junctions to confirm precise targeting

PCR ComponentVolume/ConcentrationNotes
DNA template10-50 ngPlasmid containing marker cassette
Forward primer (with 50 bp homology)0.5 μMInclude YOP1-specific homology arm
Reverse primer (with 50 bp homology)0.5 μMInclude YOP1-specific homology arm
dNTPs200 μM eachHigh-fidelity formulation recommended
High-fidelity polymerase1-2 unitsEnzyme with proofreading activity
Buffer1XAs recommended by polymerase manufacturer
Total volume50 μlScale as needed

What expression system yields optimal recombinant YOP1 in D. hansenii?

For optimal expression of recombinant YOP1 in D. hansenii, researchers should consider:

  • Genomic integration sites:

    • Safe harbor sites have been identified for stable integration of heterologous genes

    • Site selection affects expression levels and stability

  • Promoter selection:

    • Native D. hansenii promoters (e.g., ACT1) provide reliable expression

    • Inducible promoters allow controlled expression timing

  • Growth conditions optimization:

    • Salt concentration affects growth and gene expression in D. hansenii

    • Optimal performance observed with 1M NaCl supplementation

    • Combined effect of pH 4 and high salt content shows positive impact on growth

  • Verification of expression:

    • Western blotting with appropriate antibodies

    • Fluorescent tagging for localization studies

High-throughput screening methods using robotics and automation devices, as described for D. hansenii strain characterization , can be adapted to optimize expression conditions for recombinant YOP1.

How should chemostat experiments be designed for studying YOP1 function?

Chemostat experiments allow precise control of growth conditions and are ideal for studying YOP1 function in D. hansenii. Based on published methodologies :

  • Experimental setup:

    • Maintain constant volume using overflow weir systems

    • Establish steady-state conditions where cell growth rate equals dilution rate

  • Media composition:

    • Compare growth with either NaCl or KCl (1 M) to distinguish ion-specific effects

    • Control carbon source based on utilization profiles (glucose preferred over arabinose/xylose)

  • Sampling strategy:

    • Collect samples at steady state for transcriptome, proteome, and phosphoproteome analysis

    • Monitor multiple time points to capture dynamic responses

  • Analysis approaches:

    • Compare YOP1 expression levels under different salt conditions

    • Examine co-expression patterns with known stress-response genes

    • Analyze phosphorylation state changes in YOP1 under varying conditions

This experimental design allows researchers to directly assess how YOP1 responds to specific environmental conditions while maintaining other variables constant.

How can researchers distinguish between direct and indirect effects of YOP1 manipulation?

Distinguishing direct from indirect effects of YOP1 manipulation requires systematic experimental approaches:

  • Time-course experiments:

    • Direct effects typically manifest more rapidly than indirect consequences

    • Monitor cellular responses at multiple time points after YOP1 perturbation

  • Conditional expression systems:

    • Use inducible promoters to control YOP1 expression timing

    • Correlate phenotypic changes with YOP1 expression levels

  • Interaction studies:

    • Identify direct binding partners of YOP1 through co-immunoprecipitation

    • Verify interactions using techniques like Bimolecular Fluorescence Complementation

  • Comparative genomics:

    • Examine YOP1 conservation and co-evolution patterns across yeast species

    • Identify conserved interaction networks that suggest direct functional relationships

  • Statistical analysis approaches:

    • Calculate correlation coefficients between YOP1 expression and phenotypic outcomes

    • Use multivariate analysis to separate direct and indirect effects in complex datasets

What statistical methods are appropriate for analyzing YOP1 recombination experiments?

When analyzing recombination rates involving YOP1 or other genetic loci in D. hansenii, appropriate statistical methods include:

  • Fluctuation tests:

    • Based on Luria-Delbrück methodology as described in yeast recombination studies

    • Allows determination of spontaneous recombination rates

    • Transfer single colonies to liquid medium, grow to saturation, and plate appropriate dilutions

  • Replica-pinning high-throughput approach:

    • Robotic pinning of yeast strain arrays allows analysis of multiple independent colonies

    • Provides semi-quantitative estimate of low-frequency events

    • Calculate ratio of recombinants to total colonies to determine recombination frequency

  • Statistical validation:

    • Use Student's t-test with appropriate significance cutoff (e.g., P = 0.05)

    • Perform multiple independent experiments to ensure reproducibility

    • Consider Bonferroni correction for multiple hypothesis testing

  • Data visualization:

    • Colony measurement using ImageJ software package with appropriate plugins

    • Filter data to exclude artifacts (e.g., require colony circularity >0.8)

These approaches provide robust quantification of recombination events and allow for statistically valid comparisons between experimental conditions.

How can D. hansenii YOP1 expression systems be adapted for industrial applications?

While avoiding commercial aspects, researchers should consider how laboratory findings might translate to larger-scale applications:

  • Scale-up considerations:

    • D. hansenii's halotolerance reduces contamination risk in non-sterile conditions

    • Salt-induced protective effects improve culture robustness

  • Bioprocess optimization:

    • D. hansenii shows potential for industrial bioprocesses using lignocellulosic and non-lignocellulosic feedstocks

    • Semi-controlled micro-fermentations can identify optimal conditions before scaling

  • Bioreactor design:

    • Chemostat systems maintain steady-state conditions for consistent protein production

    • Salt concentration affects growth parameters and must be optimized

  • Strain development opportunities:

    • The PCR-based gene targeting system enables efficient engineering of wild-type isolates

    • Heterologous protein expression at chromosomal safe harbor sites has been demonstrated

What are the key research gaps in understanding YOP1 function in D. hansenii?

Several critical knowledge gaps remain in understanding YOP1 function in D. hansenii:

  • Salt-specific responses:

    • How YOP1 phosphorylation patterns differ between Na+ and K+ exposure

    • Whether YOP1 directly interacts with ion transporters or channels

  • Stress integration mechanisms:

    • How YOP1 contributes to D. hansenii's ability to thrive in multiple stress conditions

    • The relationship between ER morphology and stress adaptation

  • Evolutionary adaptations:

    • Sequence and functional differences between D. hansenii YOP1 and homologs in conventional yeasts

    • Whether YOP1 has acquired novel functions in this halotolerant species

  • Regulatory networks:

    • Transcription factors controlling YOP1 expression under various conditions

    • How YOP1 activity is regulated post-translationally

Addressing these gaps will require integration of genomic, transcriptomic, proteomic, and phosphoproteomic approaches as demonstrated in recent D. hansenii studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.