Recombinant Debaryomyces hansenii Translocation protein SEC62 (SEC62)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SEC62; DEHA2G12386g; Translocation protein SEC62
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Target Names
Target Protein Sequence
MAEVPITTSNQRSQVAINIANYLKDNKILKQRTGLLNNSEDVEFFRYKRLARALLSDDYK TKQANHKNGLIPIADEQEAAKVFITLIQSQFVIPVEKLHYNEIKQANKSWKPNKTKPTLK QSTKANIEPNAYFVWTYNKPNPFILLYSILLLVGIFTIILFPLWPNFMKIGVWYLSMGLL GLLGLFFLIAIIRLIIYIITLLVLPRAFWLYPNLFEDCGVLESFQPLYGWDEPKKSKKGK SSKSASKPETESSGAATGVKPAENAPTKRKVVLEEVDE
Uniprot No.

Target Background

Function

Essential for preprotein translocation.

Database Links
Protein Families
SEC62 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SEC62 and what are its primary functions?

SEC62 is a translocation protein located in the endoplasmic reticulum membrane that mediates post-translational transport of precursor polypeptides across the ER. It acts as a targeting receptor for small presecretory proteins containing short and apolar signal peptides, properly positioning newly synthesized presecretory proteins into the SEC61 channel-forming translocon complex. This positioning triggers channel opening for polypeptide translocation to the ER lumen . Additionally, SEC62 has been identified as an autophagy receptor that selectively delivers ER components to autolysosomes for clearance during recovery from ER stress, making it a critical molecular component in maintenance and recovery of ER homeostasis .

How does Debaryomyces hansenii SEC62 differ from mammalian SEC62?

Debaryomyces hansenii SEC62, similar to its mammalian counterparts, functions as a translocation protein but exhibits specific amino acid sequence variations. The full-length D. hansenii SEC62 comprises 278 amino acids with a sequence that includes multiple transmembrane domains and a cytosolic region containing regulatory elements . While the core translocation function is conserved across species, D. hansenii SEC62 has species-specific variations that may impact its interactions with other translocon components. Unlike mammalian SEC62, which has been extensively studied for its roles in both translocation and autophagy, the dual functionality of D. hansenii SEC62 in autophagy (ER-phagy) requires further investigation to determine the conservation of this mechanism across evolutionary distance.

What structural domains of SEC62 are critical for its translocation function?

SEC62 contains multiple functional domains essential for its activity in protein translocation. The protein features transmembrane domains that anchor it in the ER membrane and a cytosolic domain containing regulatory elements. Of particular importance is the LIR (LC3-interacting region) motif in the cytosolic domain, which is crucial for the protein's function in autophagy but not required for its role in protein translocation . Research using SEC62 mutants with altered LIR domains (SEC62LIRmut) has demonstrated that while these mutations disrupt the protein's function in ER-phagy during stress recovery, they do not affect its translocation capabilities. Translocation assays have shown that both wild-type SEC62 and SEC62LIRmut are equally effective in complementing SEC62 knockout cells for protein translocation functions .

What are the optimal conditions for working with recombinant Debaryomyces hansenii SEC62 protein?

When working with recombinant D. hansenii SEC62 protein, researchers should maintain specific storage and handling conditions to preserve protein stability and function. The protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended preservation . Repeated freeze-thaw cycles should be avoided, and working aliquots can be maintained at 4°C for up to one week. For experimental applications, researchers should be aware that the tag type (such as Myc/DDK tags used in some commercial preparations) may vary depending on the production process and could affect certain protein-protein interaction studies .

How can I design effective SEC62 knockout experiments using CRISPR/Cas9?

To generate SEC62 knockout cell lines using CRISPR/Cas9 technology, researchers should:

  • Design guide RNAs targeting conserved exonic regions of the SEC62 gene, preferably early coding sequences to ensure complete functional disruption.

  • Consider potential gene amplification, as seen in cancer cell lines, which may require multiple rounds of Cas9 activity to achieve complete knockout.

  • Validate CRISPR events through next-generation sequencing (NGS) and analyze data using platforms like CRISPResso2 to identify generated alleles.

  • Confirm knockout at the protein level using Western blot analysis, comparing expression levels with wild-type cells.

In a case study using FaDu cells (hypopharyngeal cancer cell line), researchers successfully generated SEC62 knockout clones where 88.5-92.1% of sequencing reads showed alterations from the reference genome, with the most common modifications being single nucleotide insertions or deletions of 5-15 nucleotides near the PAM sequence . This methodological approach ensures comprehensive validation of the knockout at both genetic and protein levels.

How does SEC62 contribute to ER stress recovery mechanisms?

SEC62 plays a critical role in recovery from ER stress through its function as an autophagy receptor. During normal ER stress, cells activate the unfolded protein response (UPR), leading to increased expression of ER-resident chaperones and folding factors. After stress resolution, SEC62 selectively delivers excess ER components to autolysosomes for clearance, facilitating the return to pre-stress ER homeostasis .

This process can be experimentally demonstrated using cyclopiazonic acid (CPA), a reversible inhibitor of the sarco/endoplasmic reticulum calcium pump, to induce reversible ER stress. Upon CPA washout, SEC62 mediates the delivery of ER marker proteins to LAMP1-positive vesicles (autolysosomes) for degradation. Knockout or silencing of SEC62 inhibits this delivery and delays the return of excess ER marker proteins to pre-stress levels . These findings identify SEC62 as a key regulator of ER size and composition during recovery from stress conditions.

What is the relationship between SEC62 and calcium homeostasis in the ER?

SEC62 functions in intracellular Ca2+ homeostasis by influencing Ca2+ efflux from the ER lumen. Experimental evidence suggests that functional inhibition of SEC62 stimulates Ca2+ efflux from the ER, thereby increasing cellular stress levels . This connection between SEC62 and calcium regulation provides a mechanistic explanation for how SEC62 inhibition might exert anti-cancer effects, as disruption of ER calcium homeostasis can induce cellular stress responses that limit tumor growth and metastasis formation.

The relationship can be examined using calcium imaging techniques in cells with manipulated SEC62 expression levels or through functional assays with compounds that antagonize SEC62 function, such as trifluoperazine and thapsigargin . These methodological approaches allow researchers to quantify changes in calcium flux and correlate them with cellular stress markers.

How is SEC62 implicated in cancer development and progression?

SEC62 has emerged as a potential driver oncogene in cancer development, with the SEC62 gene frequently amplified in various cancer types, particularly in head and neck squamous cell carcinomas (HNSCC) associated with chromosomal region 3q26 amplification . High SEC62 expression levels have been observed across multiple cancer entities and are associated with poor clinical outcomes and increased metastatic burden.

The oncogenic role of SEC62 is supported by functional studies showing that SEC62 knockdown or knockout can reduce cancer cell proliferation and migration. For example, CRISPR/Cas9-mediated SEC62 knockout in HNSCC cell lines demonstrates altered cellular behavior and increased sensitivity to SEC62-targeted therapies . These findings suggest that SEC62 plays a role in promoting cancer progression, potentially through its functions in ER homeostasis, stress response, and calcium regulation.

What therapeutic approaches target SEC62 function in disease models?

Therapeutic strategies targeting SEC62 function focus on functional inhibition rather than direct targeting with antibodies, as SEC62's intracellular localization in the ER membrane makes it poorly accessible to therapeutic antibodies . Two potential approaches include:

  • Compounds that antagonize SEC62 function in intracellular Ca2+ homeostasis, such as trifluoperazine and thapsigargin, which have shown anti-metastatic and anti-proliferative effects in both in vitro assays and orthotopic murine models of HNSCC .

  • Genetic approaches using siRNA or CRISPR/Cas9 technology to achieve functional SEC62 knockdown or knockout, which can limit tumor growth and metastasis formation by increasing cellular stress levels through stimulated Ca2+ efflux from the ER lumen.

These approaches demonstrate the potential of SEC62-targeted therapies in cancer treatment, particularly for cancers with SEC62 amplification or overexpression.

How can we identify proteins cleared through SEC62-mediated ER-phagy?

To identify proteins cleared through SEC62-mediated ER-phagy, researchers can employ a strategy comparing cells expressing wild-type SEC62 versus SEC62LIRmut (with inactive autophagy function). The methodological approach involves:

  • Inducing ER stress followed by recovery in cells expressing either SEC62 or SEC62LIRmut.

  • Treating cells with Bafilomycin A1 (BafA1) to inhibit lysosomal degradation and allow accumulation of autophagy substrates.

  • Enriching autolysosomal vesicles (AV) using isopycnic density gradients, where AV markers like LC3-II and p62/Sequestosome float to the lightest fractions.

  • Analyzing the protein content of these fractions using mass spectrometry-based label-free quantification (MS-LFQ) .

This approach identified PDI family members among proteins depleted from autolysosomal fractions in cells expressing SEC62LIRmut compared to wild-type SEC62, indicating that these proteins are targeted for degradation through SEC62-mediated ER-phagy . This methodology allows for comprehensive identification of SEC62's autophagy substrates, providing insight into which ER components are selectively cleared during stress recovery.

Can SEC62 function be modulated to enhance recombinant protein production?

Given SEC62's role in protein translocation and ER homeostasis, modulating its function could potentially enhance recombinant protein production in expression systems. Researchers might consider:

  • Precise SEC62 overexpression to enhance translocation capacity without triggering excessive ER-phagy, potentially increasing throughput of secretory proteins.

  • Engineering SEC62 variants with enhanced translocation function but reduced autophagy activity through mutations in the LIR domain.

  • Co-expression of SEC62 with other translocon components to optimize the stoichiometry of the translocation machinery.

What are common challenges in analyzing SEC62 function and how can they be addressed?

Researchers investigating SEC62 function may encounter several challenges:

  • Overlapping functions: SEC62 participates in both protein translocation and ER-phagy, making it difficult to isolate specific functions. Solution: Use SEC62LIRmut constructs, which maintain translocation function but lose autophagy activity, allowing separation of these functions in experimental settings .

  • Compensatory mechanisms: Cellular adaptation to SEC62 knockout may activate alternative pathways. Solution: Employ inducible knockout/knockdown systems or acute inhibition strategies to minimize adaptation.

  • Validation of knockout efficiency: SEC62 gene amplification in some cell lines requires multiple rounds of CRISPR/Cas9 activity. Solution: Comprehensive validation through NGS to identify all generated alleles, combined with protein-level analysis by Western blot .

  • Assessing autophagy flux: Distinguishing SEC62-mediated selective ER-phagy from general autophagy. Solution: Use specific markers of ER-phagy and autophagy inhibitors like Bafilomycin A1 to properly assess autophagic flux, combined with co-localization studies of ER markers with autophagosomal/lysosomal markers .

How can researchers optimize translocation assays to study SEC62 function?

To optimize translocation assays for studying SEC62 function, researchers should:

In translocation assays using ERj3 as a reporter, researchers have demonstrated that:

  • Translocation is compromised in SEC62 knockout (CRISPR62) cells

  • Expression of either SEC62 or SEC62LIRmut re-establishes translocation

  • Translocation efficiency in wild-type cells is not measurably affected during ER stress or during recovery from ER stress

This methodological approach allows for specific assessment of SEC62's translocation function independent of its role in ER-phagy.

What are emerging areas of SEC62 research with potential significance?

SEC62 research is expanding beyond its classical role in protein translocation to explore its functions in cellular homeostasis, stress response, and disease. Emerging areas include:

  • The dual role of SEC62 in protein translocation and selective autophagy, particularly how these functions are regulated and coordinated.

  • SEC62's contribution to cancer progression and its potential as a therapeutic target, especially in tumors with 3q26 amplification.

  • The relationship between SEC62 and calcium homeostasis, which may reveal new mechanisms of cellular stress response and adaptation.

  • Species-specific variations in SEC62 function, particularly comparing yeast models like Debaryomyces hansenii with mammalian systems to identify conserved and divergent mechanisms.

These research directions will continue to enhance our understanding of SEC62's multifaceted roles in cellular biology and may lead to novel therapeutic strategies for diseases characterized by ER dysfunction or SEC62 dysregulation.

What methodological advances are needed to better study SEC62 function?

Advancing SEC62 research will require methodological improvements in several areas:

  • Development of specific small molecule inhibitors of SEC62 function that can distinguish between its roles in translocation and autophagy.

  • Improved imaging techniques to visualize SEC62-mediated ER-phagy in real-time, potentially through development of fluorescent sensors for this specific process.

  • Systems biology approaches to map the complete interactome of SEC62 under various cellular conditions, including stress and recovery phases.

  • Advanced genome editing techniques to introduce specific point mutations or domain modifications that can dissect SEC62 function with greater precision than conventional knockout approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.