Recombinant Dechloromonas aromatica Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Overview of Disulfide Bond Formation Protein B (DsbB)

DsbB is a membrane-bound oxidoreductase critical for catalyzing disulfide bond formation in bacterial periplasmic and secreted proteins. In Escherichia coli, DsbB regenerates the active-site disulfide of DsbA, the primary oxidase responsible for introducing disulfide bonds into substrate proteins . This process involves electron transfer from reduced DsbA to ubiquinone/menaquinone via DsbB’s two catalytic disulfide pairs (Cys41–Cys44 and Cys104–Cys130) . While DsbB homologs are well-characterized in model organisms like E. coli and Salmonella, limited data exist for Dechloromonas aromatica, a soil microbe known for anaerobic benzene degradation and perchlorate reduction .

Genomic and Functional Insights into Dechloromonas aromatica DsbB

FeatureInferred Properties (Based on Homologs)
Active SiteLikely contains two catalytic disulfide pairs (CXXC motifs)
Membrane TopologyPredicted four transmembrane helices
Redox PartnersUbiquinone/menaquinone as terminal electron acceptors
Functional RoleReoxidation of a DsbA-like oxidase

Recombinant Expression and Applications

Recombinant D. aromatica DsbB has not been explicitly studied, but heterologous expression systems (e.g., E. coli) are commonly used to produce disulfide bond-forming proteins . Challenges include:

  • Membrane Localization: DsbB’s integral membrane nature complicates soluble expression .

  • Redox Activity: Requires co-expression with partner oxidase (e.g., DsbA) and quinones .

Potential Applications:

  • Bioremediation: Enhancing oxidative folding of enzymes involved in pollutant degradation .

  • Industrial Protein Production: Optimizing disulfide bond formation in recombinant proteins .

Research Gaps and Future Directions

  1. Structural Characterization: No crystal structures or biochemical assays for D. aromatica DsbB exist. Comparative studies with E. coli DsbB (PDB: 1FVK) could clarify evolutionary adaptations .

  2. Redox Potential: Measurement of its catalytic disulfide bonds’ redox potential (e.g., via cyclic voltammetry) is needed .

  3. Substrate Specificity: Identification of partner oxidases (e.g., DsbA homologs) in D. aromatica .

Comparative Analysis with Model Systems

PropertyE. coli DsbBD. aromatica DsbB (Predicted)
Catalytic DisulfidesCys41–Cys44, Cys104–Cys130 Conserved CXXC motifs inferred
Redox Potential−69 mV (Cys41–Cys44) Unknown
Electron AcceptorUbiquinone-8 Likely menaquinone (anaerobic)
Genetic ContextMonocistronic Uncharacterized

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
dsbB; Daro_3145; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Dechloromonas aromatica (strain RCB)
Target Names
dsbB
Target Protein Sequence
MICSKVPVRAWFATLGLGCLGLVAVGMALQTLLHLAPCPLCIFQRLLYIMIGFVGLLGFV LPAGRLLWSTLAAGLGVLGFGVAAYQTWMQAFPDLAPECGFTDPNAIERLVDWLGMEWPS MFLATGFCTSRDWELLGLSMANWSVLIFAGIVAYAVLLFVRKDRA
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.