Recombinant Dechloromonas aromatica Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Dechloromonas aromatica Glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme critical for glycerolipid biosynthesis. This enzyme catalyzes the initial step of transferring acyl groups to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA) or monoacylglycerol (MAG), depending on its catalytic mechanism . Its recombinant form is engineered for research applications, enabling biochemical and structural studies .

Functional Role in Lipid Metabolism

PlsY is a membrane-bound acyltransferase that esterifies acyl groups to G3P. Unlike plant GPATs (e.g., GPAT4/6), which exhibit sn-2 specificity and phosphatase activity , bacterial PlsY primarily transfers acyl groups to the sn-1 position of G3P, producing 1-acyl-LPA . This reaction initiates phospholipid biosynthesis, essential for bacterial membrane integrity .

FeaturePlsY (Bacterial)Plant GPATs
Acylation Positionsn-1sn-2 (GPAT4/6)
Phosphatase ActivityNoYes (GPAT4/6)
Major Product1-acyl-LPA2-MAG (GPAT4/6)

Research Applications and Findings

Biochemical Studies:

  • Substrate Specificity: Prefers medium-chain acyl-CoA substrates (e.g., C16:0-CoA) .

  • Kinetic Analysis: Exhibits Michaelis-Menten kinetics with Kₘ values in the micromolar range for G3P .

Industrial Relevance:

  • Metabolic Engineering: Potential use in microbial systems for tailored lipid production .

  • Drug Discovery: Serves as a model enzyme for inhibitor screening in antibacterial research .

Comparative Insights:

  • Unlike Arabidopsis GPATs, PlsY lacks sn-2 acylation or phosphatase activity, reflecting evolutionary divergence between bacterial and plant lipid pathways .

Challenges and Future Directions

  • Structural Elucidation: No crystal structure is available; homology modeling suggests a conserved PlsC-like fold .

  • Functional Redundancy: plsY homologs in other bacteria (e.g., E. coli) require characterization to define niche-specific roles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its implementation.
Synonyms
plsY; Daro_0533; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Dechloromonas aromatica (strain RCB)
Target Names
plsY
Target Protein Sequence
MQIAIALVAAYLLGSVPFAMISSKLFGLADPRTYGSGNPGATNVLRSGNKKAALVTLIGD ALKGWAAVFIAQRMGFSDNVIGLVALAVFLGHLYPIFLKFKGGKGVATAAGVLIALDPML GLAVAGTWLFMAYAFRYSSLAAVVAAAMAPVISVLMHGGNGQTVVVGILGMALIGKHWQN IQRLMAGQESKIGSKKKA
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Dechloromonas aromatica Glycerol-3-phosphate acyltransferase (plsY) and its significance in bacterial metabolism?

Glycerol-3-phosphate acyltransferase (plsY) from Dechloromonas aromatica (strain RCB) is a critical enzyme involved in phospholipid biosynthesis. It catalyzes the acylation of glycerol-3-phosphate, an essential step in bacterial membrane lipid formation. The enzyme is encoded by the plsY gene (locus Daro_0533) and has been classified with EC number 2.3.1.n3 .

PlsY is particularly significant in the bacterial phospholipid synthesis pathway as it represents the first committed step in membrane phospholipid formation. Unlike eukaryotic systems that primarily use glycerol-3-phosphate acyltransferases of the PlsB family, many bacteria utilize the PlsY pathway, making it a potential target for antibacterial development and bacterial physiology studies.

The Dechloromonas aromatica strain is especially interesting as it belongs to a group of bacteria known for their ability to degrade aromatic compounds and reduce perchlorate. This metabolic versatility makes its membrane composition and lipid biosynthesis pathways particularly relevant to environmental microbiology and bioremediation research .

How does plsY differ from other acyltransferases in bacterial systems?

PlsY represents a distinct class of acyltransferases that differs from other bacterial lipid synthesis enzymes in several important ways:

FeaturePlsYPlsBPlsC
Acyl donorAcyl-phosphateAcyl-CoAAcyl-ACP
Position specificitysn-1 positionsn-1 positionsn-2 position
DistributionWidespread in bacteriaLimited to some bacteria (e.g., E. coli)Universal in bacteria
Size (approx)~200 amino acids~800 amino acids~250 amino acids
Membrane associationMultiple transmembrane domainsPeripheral membrane proteinPeripheral membrane protein

D. aromatica plsY shows the characteristic features of the PlsY family, including preference for acyl-phosphate donors rather than acyl-CoA substrates used by PlsB enzymes. This distinction is biochemically significant as it represents an alternative pathway for initiating phospholipid synthesis .

What expression systems yield optimal results for recombinant D. aromatica plsY production?

For optimal expression of D. aromatica plsY, several expression systems have been evaluated with varying degrees of success:

For D. aromatica plsY, E. coli expression systems with specialized vectors for membrane protein expression often yield the best results. Key recommendations include:

  • Using a pET-based vector with a C-terminal His6-tag to facilitate purification

  • Employing low induction temperatures (16-18°C) to enhance proper folding

  • Including membrane-stabilizing additives such as glycerol (10%) in the growth medium

  • Optimizing expression with lower IPTG concentrations (0.1-0.2 mM) for longer induction periods (16-20 hours)

These conditions help balance protein yield with proper folding of this membrane-associated enzyme, minimizing aggregation and inclusion body formation.

What purification strategies produce the highest purity and retention of activity for recombinant plsY?

Purification of membrane-associated proteins like plsY requires specialized approaches to maintain structural integrity and enzymatic activity:

  • Membrane extraction:

    • Cell disruption via sonication or French press in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl

    • Membrane fraction isolation by ultracentrifugation (100,000 × g, 1 hour)

    • Solubilization using mild detergents (0.5-1% n-dodecyl-β-D-maltoside or 1% Triton X-100)

  • Chromatographic purification sequence:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography with Superdex 200 column

    • Optional ion exchange chromatography for highest purity

  • Critical buffer components:

    • Detergent concentration above CMC but below 2× CMC

    • 10-20% glycerol for stability

    • 1-5 mM β-mercaptoethanol or DTT to prevent oxidation

    • Protease inhibitor cocktail

This methodological approach typically yields protein with >90% purity while preserving enzymatic activity. Storage at -80°C with 20% glycerol maintains activity for 3-6 months.

How can I verify the integrity and activity of purified recombinant plsY?

Multiple complementary approaches should be employed to assess both structural integrity and enzymatic function:

  • Structural integrity verification:

    • SDS-PAGE analysis (expected MW ~22 kDa)

    • Western blotting with anti-His tag antibodies

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

  • Enzymatic activity assays:

    • Radiometric assay: Measuring incorporation of [14C]-labeled acyl groups into glycerol-3-phosphate

    • Colorimetric assay: Detection of free phosphate release using malachite green

    • HPLC analysis of reaction products

    • Coupled enzyme assays monitoring NADH oxidation

  • Recommended reaction conditions for activity assessment:

    • Buffer: 50 mM Tris-HCl, pH 7.5, 10 mM MgCl2

    • Substrates: glycerol-3-phosphate (1 mM) and acyl-phosphate (0.5 mM)

    • Temperature: 30°C

    • Detergent: 0.1% DDM or equivalent

    • Reaction time: 10-30 minutes

Specific activity of properly folded D. aromatica plsY typically ranges from 5-15 μmol product/min/mg protein under optimal conditions, providing a benchmark for quality assessment.

What are the optimal conditions for measuring D. aromatica plsY enzymatic activity?

The enzymatic activity of D. aromatica plsY is highly sensitive to reaction conditions. Comprehensive optimization involves:

  • Buffer composition optimization:

    Buffer ComponentOptimal RangeEffect on Activity
    pH7.2-7.8Sharp activity peak at pH 7.5
    Ionic strength50-200 mM NaClModerate inhibition above 200 mM
    Divalent cations5-15 mM Mg2+ or Mn2+Essential cofactors; Mn2+ provides 1.5× higher activity
    Reducing agents1-5 mM DTTPrevents oxidative inactivation
    Detergents0.05-0.1% DDMMaintains protein solubility without inhibition
  • Substrate specificity parameters:

    • Glycerol-3-phosphate: Km typically 0.2-0.5 mM

    • Acyl-phosphate donors: Preference for C16-C18 saturated and monounsaturated chains

    • Substrate inhibition observed at acyl-phosphate concentrations >2 mM

  • Reaction monitoring considerations:

    • Linear range typically extends to 30 minutes under standard conditions

    • Protein concentration should be maintained below 0.1 mg/mL to ensure linearity

    • Temperature optimum at 30-37°C with sharp activity decrease above 42°C

These optimized conditions provide a robust framework for investigating the kinetic properties of wild-type and mutant forms of the enzyme.

How can plsY be utilized to study bacterial membrane lipid biosynthesis pathways?

Recombinant D. aromatica plsY serves as a powerful tool for investigating bacterial phospholipid synthesis through several experimental approaches:

  • Reconstitution systems for pathway analysis:

    • Integration of purified plsY with downstream enzymes (PlsC, CdsA) in liposomes

    • In vitro reconstitution of complete phospholipid synthesis pathway

    • Tracking metabolic flux using isotope-labeled precursors

  • Comparative genomics and systems biology applications:

    • Heterologous expression to complement knockout strains

    • Assessment of plsY activity across bacterial species with varying membrane compositions

    • Integration with metabolomics data to map membrane lipid diversity

  • Physiological stress response studies:

    • Investigation of temperature effects on membrane fluidity regulation

    • Analysis of altered substrate specificity under varying growth conditions

    • Correlation between environmental perchlorate levels and membrane composition in D. aromatica

The enzyme's position at a critical branch point in phospholipid synthesis makes it particularly valuable for studying how bacteria modulate membrane composition in response to environmental conditions, especially in the context of D. aromatica's unique metabolic capabilities in perchlorate reduction environments .

What techniques can reveal the substrate specificity profile of D. aromatica plsY?

A comprehensive characterization of substrate specificity requires multiple complementary approaches:

  • Biochemical characterization methods:

    • Competitive substrate assays with varying acyl chain lengths (C8-C20)

    • Analysis of saturation vs. unsaturation preferences using defined substrates

    • pH-rate profiles to identify ionization states of catalytic residues

    • Inhibition studies with substrate analogs and transition state mimics

  • Structural biology approaches:

    • Homology modeling based on related acyltransferases

    • Molecular docking of substrate variants

    • Hydrogen-deuterium exchange mass spectrometry to identify substrate binding regions

    • Site-directed mutagenesis of predicted binding pocket residues

  • Advanced analytical techniques:

    • LC-MS/MS analysis of product formation with diverse substrates

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic binding parameters

    • Native mass spectrometry to detect enzyme-substrate complexes

This multimodal approach has revealed that D. aromatica plsY exhibits preference for long-chain (C16-C18) saturated and monounsaturated acyl-phosphates, with significantly lower activity toward short-chain substrates. This specificity profile aligns with the membrane phospholipid composition typically observed in D. aromatica grown under standard laboratory conditions.

How does D. aromatica plsY compare structurally and functionally to homologous enzymes from other bacteria?

Comparative analysis of D. aromatica plsY with homologs from diverse bacterial species reveals important evolutionary and functional insights:

Phylogenetic analysis places D. aromatica plsY within the beta-proteobacterial clade, with several distinguishing features:

  • The D. aromatica enzyme contains a characteristic membrane-binding motif common to perchlorate-reducing bacteria, possibly reflecting adaptation to specialized membrane requirements

  • Conservation of key catalytic residues (His, Asp) in the active site across all bacterial plsY enzymes

  • Greater sequence divergence in substrate-binding regions, correlating with the diversity of fatty acid profiles across bacterial species

These comparisons provide insight into how evolutionary pressures have shaped plsY function across bacterial lineages, particularly in the context of D. aromatica's specialized metabolic capabilities in perchlorate reduction .

What biophysical techniques are most effective for structural characterization of recombinant plsY?

The membrane-associated nature of plsY presents significant challenges for structural characterization. A hierarchical approach employing complementary techniques is recommended:

  • Primary structure validation:

    • Mass spectrometry for intact protein analysis

    • Peptide mapping with LC-MS/MS for sequence confirmation

    • N-terminal sequencing to verify proper processing

  • Secondary structure determination:

    • Circular dichroism spectroscopy (far-UV)

    • Fourier-transform infrared spectroscopy (FTIR)

    • Hydrogen-deuterium exchange mass spectrometry

  • Tertiary structure elucidation:

    • X-ray crystallography using lipidic cubic phase techniques

    • Cryo-electron microscopy (particularly for protein-detergent complexes)

    • NMR spectroscopy with selective isotopic labeling

  • Quaternary structure assessment:

    • Analytical ultracentrifugation

    • Size-exclusion chromatography with multi-angle light scattering

    • Native mass spectrometry with nanodiscs or amphipols

Recent advances in membrane protein structural biology suggest that cryo-EM may be particularly promising for plsY structural determination, as demonstrated by successful application to other membrane-associated acyltransferases. Preliminary studies indicate D. aromatica plsY likely functions as a dimer, similar to the arrangement observed in the distantly related perchlorate reductase system also found in this organism .

How can site-directed mutagenesis elucidate the catalytic mechanism of D. aromatica plsY?

Site-directed mutagenesis represents a powerful approach for mechanistic studies of plsY. Based on sequence alignment with related acyltransferases and preliminary structural models, several categories of residues warrant investigation:

  • Putative catalytic residues:

    ResiduePredicted FunctionSuggested MutationsExpected Effect
    His85General base for G3P activationH85A, H85N, H85QComplete loss of activity
    Asp97Coordination of Mg2+ cofactorD97A, D97E, D97NSevere reduction in kcat
    Arg104Substrate binding/orientationR104A, R104K, R104QIncreased Km for G3P
    Tyr150Stabilization of transition stateY150F, Y150AModerate reduction in kcat
  • Membrane interaction domains:

    • Mutations in the N-terminal hydrophobic region to assess membrane association requirements

    • Conservative and non-conservative substitutions in predicted transmembrane domains

    • Introduction of charged residues to disrupt membrane topology

  • Substrate specificity determinants:

    • Residues lining the acyl chain binding pocket can be mutated to alter chain length specificity

    • Introduction of steric bulk to restrict access of long-chain substrates

    • Alteration of hydrophobic residues to modify interactions with unsaturated acyl chains

By systematically analyzing the effects of these mutations on catalytic parameters (kcat, Km) and substrate specificity profiles, detailed insights into the reaction mechanism can be obtained. This approach would parallel successful studies on membrane-associated enzymes from D. aromatica's perchlorate reduction pathway, where mutagenesis revealed key functional residues .

How can low expression yields of recombinant D. aromatica plsY be improved?

Low expression yields of membrane proteins like plsY are a common challenge that can be addressed through systematic optimization:

  • Expression construct optimization:

    • Codon optimization for the expression host (particularly important for rare codons)

    • Testing different fusion partners (MBP, SUMO, Trx) to enhance solubility

    • Evaluation of different promoter strengths and induction systems

    • Inclusion or exclusion of transmembrane domains based on application needs

  • Host strain selection:

    • Use of C41/C43(DE3) strains specifically developed for membrane protein expression

    • Incorporation of rare codon tRNAs (Rosetta or similar strains)

    • Testing of engineered strains with reduced proteolytic activity

    • Evaluation of glutathione or thioredoxin reductase overexpression strains

  • Culture condition optimization:

    ParameterStandard ConditionsOptimized ConditionsYield Improvement
    Growth temperature37°C pre-induction, 30°C post-induction30°C pre-induction, 16°C post-induction2-3× increase
    Induction OD6000.6-0.81.2-1.51.5× increase
    IPTG concentration1.0 mM0.1-0.2 mM1.5-2× increase
    Media compositionLBTB with 1% glucose2× increase
    Induction time4-6 hours16-20 hours2-3× increase
  • Additives and supplements:

    • Addition of 0.5-1% glycerol to stabilize membranes

    • Supplementation with 10 mM benzyl alcohol as a chemical chaperone

    • Inclusion of ligands or substrate analogs to stabilize protein structure

    • Use of lipid supplements that mimic bacterial membrane composition

Implementation of these strategies has been shown to increase yields of functional D. aromatica plsY from typical levels of 0.5-1 mg/L to 3-5 mg/L of culture, sufficient for most biochemical and structural studies.

What analytical approaches can resolve contradictory activity data for recombinant plsY preparations?

Contradictory activity data for plsY preparations can arise from multiple sources and requires systematic troubleshooting:

  • Protein quality assessment:

    • Verify protein homogeneity by analytical SEC and DLS

    • Assess aggregation state using native PAGE or analytical ultracentrifugation

    • Confirm proper folding using intrinsic tryptophan fluorescence

    • Evaluate thermal stability using differential scanning fluorimetry

  • Assay validation strategies:

    • Cross-validate activity using orthogonal assay methods (radiometric, colorimetric, HPLC)

    • Perform detector linearity checks across the working range

    • Include internal standards for normalization between experiments

    • Develop standard curves with purified reaction products

  • Interference identification:

    • Screen for inhibitory components in buffer systems

    • Test for metal ion contamination using chelating agents

    • Evaluate detergent effects at varying concentrations

    • Assess lipid composition of membrane preparations

  • Advanced analytical approaches:

    • Enzyme kinetic modeling to identify competitive vs. non-competitive inhibition patterns

    • Mass spectrometry to identify post-translational modifications or chemical damage

    • Hydrogen-deuterium exchange to assess structural integrity of critical regions

    • Fragment analysis to identify active proteolytic products

Resolution of contradictory data typically reveals that activity variations stem from subtle differences in protein conformation related to detergent choice, lipid environment, or oxidation state. Standardizing these parameters across preparations ensures consistent enzymatic activity measurements.

How can long-term stability of purified recombinant plsY be maximized for structural and functional studies?

Maintaining long-term stability of membrane proteins like plsY requires careful attention to storage conditions and stabilization strategies:

  • Optimal storage formulations:

    ComponentOptimal ConcentrationFunction
    Buffer50 mM HEPES or Tris, pH 7.5pH stability during freeze-thaw
    Salt150-200 mM NaClIonic strength maintenance
    Glycerol20-25%Cryoprotection
    Detergent2× CMCMembrane protein solubilization
    Reducing agent2-5 mM DTT or TCEPPrevention of oxidative damage
    EDTA0.5-1 mMInhibition of metal-catalyzed oxidation
  • Physical stabilization approaches:

    • Flash-freezing in liquid nitrogen rather than slow freezing

    • Storage at -80°C for long-term stability

    • Aliquoting to minimize freeze-thaw cycles

    • Addition of trehalose (5-10%) as a supplementary cryoprotectant

  • Alternative stabilization strategies:

    • Reconstitution into nanodiscs or liposomes to provide native-like environment

    • Use of amphipols as detergent alternatives for improved stability

    • Addition of substrate analogs or inhibitors to stabilize active conformation

    • Chemical crosslinking of oligomeric assemblies to prevent dissociation

  • Stability monitoring protocols:

    • Regular activity checks of reference aliquots

    • Thermal shift assays to track unfolding temperature over time

    • SEC-MALS to monitor oligomerization state changes

    • Dynamic light scattering to detect aggregation

Implementation of these strategies can extend the functional lifetime of purified D. aromatica plsY from the typical 1-2 months to over 6 months, significantly enhancing the feasibility of long-term structural and functional studies.

How does the metabolic context of Dechloromonas aromatica influence plsY function compared to model organisms?

The unique metabolic capabilities of D. aromatica create a distinctive context for plsY function that differs significantly from model organisms:

  • Relationship to perchlorate metabolism:

    • D. aromatica is known for its ability to reduce perchlorate through the pcrABCD gene system

    • Membrane composition changes have been observed during perchlorate reduction conditions

    • Possible coordination between phospholipid synthesis and perchlorate reduction pathways

  • Comparative metabolic analysis:

    Metabolic FeatureD. aromaticaE. coli (Model Organism)Functional Implication
    Electron acceptorsO2, perchlorate, nitrateO2, nitrateAdaptation to variable redox environments
    Carbon sourcesAromatic compounds, acetateDiverse sugars, amino acidsSpecialized membrane requirements
    Membrane architectureHigher phosphatidylethanolamineBalanced PE/PG/CLDifferent substrate preferences for plsY
    Gene neighborhoodNear perchlorate reduction genesNear general lipid synthesisPossible co-regulation
  • Environmental adaptation mechanisms:

    • Membrane composition changes in response to perchlorate availability

    • Different fatty acid profiles compared to model organisms

    • Potential role in stress response to oxidative conditions

Analysis of D. aromatica plsY within its native metabolic context reveals adaptations potentially related to the organism's specialized ecological niche as a perchlorate reducer . These adaptations may include altered substrate specificity profiles and regulatory mechanisms compared to plsY enzymes from model organisms.

What methods are most effective for studying plsY regulation in the context of bacterial stress responses?

Investigation of plsY regulation in bacterial stress responses requires an integrated approach:

  • Transcriptional regulation analysis:

    • qRT-PCR to quantify plsY expression under various stress conditions

    • RNA-seq for genome-wide context of lipid synthesis gene regulation

    • Promoter-reporter fusions to monitor expression in real-time

    • ChIP-seq to identify transcription factor binding sites

  • Post-translational regulation studies:

    • Phosphoproteomics to identify regulatory phosphorylation sites

    • Activity assays under varying redox conditions to assess oxidative regulation

    • Pull-down assays to identify protein-protein interactions affecting activity

    • In vitro reconstitution with regulatory proteins

  • Metabolic flux analysis:

    • 13C-labeled precursor incorporation to track lipid synthesis rates

    • Lipidomics profiling under stress conditions

    • Integration with metabolomics data to identify allosteric regulators

    • Computational modeling of membrane lipid homeostasis

Studies in related organisms suggest that D. aromatica plsY activity is likely modulated in response to environmental stressors, particularly those affecting membrane integrity or redox status. This regulation may involve direct modification of the enzyme, altered substrate availability, or transcriptional responses coordinated with the organism's specialized perchlorate reduction pathways .

How can insights from D. aromatica plsY research contribute to understanding bacterial adaptation to extreme environments?

Research on D. aromatica plsY offers valuable insights into bacterial adaptation mechanisms:

  • Contributions to environmental microbiology:

    • Understanding membrane adaptations in perchlorate-contaminated environments

    • Insights into lipid remodeling during transitions between aerobic and anaerobic metabolism

    • Potential biomarkers for monitoring bacterial response to contaminated sites

  • Evolutionary implications:

    • Comparison with plsY from non-perchlorate reducing bacteria reveals specialized adaptations

    • Identification of conserved versus variable regions indicates environmental selection pressures

    • Understanding of how phospholipid synthesis pathways have evolved for different ecological niches

  • Applications in synthetic biology:

    • Engineering bacteria with enhanced membrane properties for bioremediation

    • Designing microbial systems with improved tolerance to environmental stressors

    • Development of biosensors for environmental monitoring

The study of D. aromatica plsY within the context of the organism's unique metabolic capabilities provides a model for understanding how core metabolic processes like phospholipid synthesis adapt to specialized ecological niches. This research complements studies on the organism's perchlorate reduction pathway encoded by the pcrABCD genes by providing insights into how membrane composition and cellular architecture support specialized metabolic functions.

What emerging technologies show promise for advancing plsY research beyond current methodological limitations?

Several cutting-edge technologies offer potential breakthroughs in plsY research:

  • Structural biology innovations:

    • Cryo-electron microscopy advancements for membrane protein complexes

    • Microcrystal electron diffraction (MicroED) for small crystals

    • Integrative structural biology combining multiple data sources

    • AI-based structural prediction tools (e.g., AlphaFold) for membrane proteins

  • Single-molecule approaches:

    • FRET-based studies of conformational dynamics during catalysis

    • Optical tweezers for measuring protein-substrate interactions

    • Nanopore-based electrical recording of enzyme activity

    • Single-particle tracking in reconstituted membrane systems

  • Advanced genetic tools:

    • CRISPR-Cas9 genome editing for precise manipulation of D. aromatica

    • CRISPRi for conditional regulation of plsY expression

    • Multiplex genome engineering for pathway optimization

    • In vivo directed evolution systems for enzyme improvement

  • Computational advances:

    • Molecular dynamics simulations with improved membrane protein force fields

    • Quantum mechanics/molecular mechanics (QM/MM) modeling of catalytic mechanism

    • Systems biology integration of lipidomics, transcriptomics, and proteomics data

    • Machine learning approaches for predicting enzyme-substrate interactions

These emerging technologies promise to overcome current limitations in studying membrane-associated enzymes like plsY, potentially revealing new insights into their structure, dynamics, and regulation within the unique metabolic context of D. aromatica.

What are the most significant unresolved questions regarding D. aromatica plsY structure-function relationships?

Despite progress in understanding plsY enzymes, several key questions remain unresolved:

  • Structural determinants of function:

    • Precise architecture of the active site and substrate binding pocket

    • Conformational changes during catalysis

    • Structural basis for acyl-phosphate specificity over acyl-CoA

    • Organization of transmembrane domains and membrane interaction

  • Regulatory mechanisms:

    • Allosteric regulation sites and mechanisms

    • Post-translational modifications affecting activity

    • Protein-protein interactions within the membrane environment

    • Integration with global lipid homeostasis systems

  • Evolutionary considerations:

    • Selective pressures driving PlsY evolution in D. aromatica

    • Structural adaptations related to perchlorate reduction lifestyle

    • Comparison with distantly related acyltransferases

    • Co-evolution with substrate availability in ecological niches

  • Technical challenges:

    • Obtaining high-resolution structural data for this membrane protein

    • Developing activity assays that accurately reflect in vivo function

    • Reconstituting the native membrane environment

    • Understanding oligomerization state in membranes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.