Recombinant Dechloromonas aromatica Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Properties

Key characteristics of recombinant Dechloromonas aromatica MsbA include:

PropertyDetail
Source OrganismDechloromonas aromatica (strain RCB)
Expression SystemEscherichia coli
UniProt IDQ47JR8
Protein LengthPartial sequence (specific residues not provided in available data)
TagDetermined during manufacturing (commonly His-tag for purification)
Purity>85% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRecommended in deionized water with glycerol for stability

Functional Role in Lipid A Transport

MsbA is an ATP-dependent flippase critical for lipid A transport. In Dechloromonas aromatica, this protein:

  • Binds ATP via nucleotide-binding domains (NBDs) to power substrate translocation .

  • Transports lipid A across the inner membrane, enabling LPS assembly in the outer membrane .

  • Exhibits structural flexibility, transitioning between inward- and outward-facing conformations to accommodate lipid A .

Mutational studies in homologous systems (e.g., Escherichia coli MsbA) reveal that residues like R188 and R238 are critical for lipid A binding, with thermodynamic coupling energies influencing substrate affinity .

Biochemical Activity

  • ATPase Activation: MsbA homologs show ATPase activity stimulated by hexa-acylated lipid A, with a 4–5-fold increase in activity observed in E. coli MsbA upon lipid binding .

  • Inhibitor Sensitivity: First-generation inhibitors like TBT1 collapse MsbA into inward-facing conformations, blocking lipid transport .

Industrial Relevance

  • Antibiotic Target: Essentiality in gram-negative pathogens makes MsbA a promising target for novel antibiotics .

  • Biosensor Development: Reconstituted MsbA in lipid bilayers enables real-time analysis of transporter dynamics and inhibitor effects .

Comparative Analysis with Homologs

FeatureDechloromonas aromatica MsbA Escherichia coli MsbA
Expression SystemE. coliNative overexpression in E. coli
ATPase ActivityNot explicitly reported37–154 nmol ATP/min/mg (lipid-dependent)
ThermostabilityStable at -80°C (lyophilized)Temperature-sensitive mutants available

Challenges and Future Directions

  • Structural Resolution: Full-length structures of Dechloromonas aromatica MsbA are needed to clarify lipid-binding mechanisms .

  • Functional Assays: ATPase activity and lipid-flipping kinetics remain uncharacterized for this specific recombinant variant .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, kindly indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Please note: Our proteins are shipped with standard blue ice packs. Should you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; Daro_0154; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Dechloromonas aromatica (strain RCB)
Target Names
msbA
Target Protein Sequence
MSHDMTSRELYLRLLTYVRPYWKAFLAALACMGVASLAEPVFPAIMKSLLDDGFSKANGP WDWLFYPLAIMGIFLVRAIFGFLGDYLMSWVSNNVVAELRQAMFARMVRLPTRYYSDNLS GRLMSRIAYDVTGVAGAATNALTSLIKDSLSIVGLLVWLLWLNWQLTLITLSVVPFIAIV VRVFSKRLRSVARGQQESMGKITQVLQEAIEGHKVVKIFGGQSYEEDRFYESIREQRRLA MRATLASAAQSPLVQFFAASGVAIIMGVALKQASSDQTTVGSFVSFVTAMLMLMAPLKRV TDVNAPIQRGLAAAESVFSLVDEETEPDSGKEELGRAQGLVEFDGVTFTYPGSERPALDS VSLTVRPGECVALVGPSGSGKTTAANLLPRFYALDAGEIRVDGHALPNIRLNSLRDNIAL VSQDVVLFNDTIGANIAYGGKRDATLDEIRAAAKAAHALEFIDALPEGLNTMIGENGVKL SGGQRQRLAIARAILKDAPILILDEATSALDTESERHVQAALDELMRGRSTLVIAHRLST IERADRIIALAHGHKQEEGSHAELLAHDGLYARLYRMQKAEEVAV
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Dechloromonas aromatica MsbA protein?

MsbA from Dechloromonas aromatica is a "half-transporter" comprising a transmembrane domain (TMD) with 6 membrane-spanning helices, which are believed to contain the substrate-binding site, and a nucleotide-binding domain (NBD), with a total molecular mass of approximately 64.5 kDa . The functional MsbA transporter exists as a homodimer. The protein's structure includes multiple critical regions:

DomainFunctionKey Features
Transmembrane DomainContains substrate binding site6 membrane-spanning helices
Nucleotide-Binding DomainATP hydrolysisConserved Walker A/B motifs
Intracellular DomainConnects TM6 and NBDContains important residues like C315

The full amino acid sequence of D. aromatica MsbA contains 585 residues with critical regions for lipid A binding and ATP hydrolysis .

How does MsbA function in lipid transport?

MsbA functions as a lipid flippase that transports lipid A with or without core sugars from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This process is essential for the assembly of LPS in the outer membrane of Gram-negative bacteria.

The mechanism follows a "trap-and-flip" model with six steps across three nucleotide states :

  • ADP or nucleotide-free state:

    • MsbA in inward-facing conformation opens TMDs to allow LPS entry

    • Bound LPS restricts TMD opening and aligns NBDs for ATP binding

  • ATP state:

    • Conformational changes abolish LPS binding

    • Acyl chains enter periplasmic leaflet

    • MsbA rearrangement and LPS translocation occur as a concerted process

  • ATP transition state:

    • TM helices form a compact bundle after LPS release

    • Upon γ-phosphate release, MsbA returns to inward-facing conformation

This model differs from the "credit card model" proposed for P4-ATPase flippases and TMEM16 scramblases, where hydrophobic acyl chains remain in the membrane during flipping .

Why is Dechloromonas aromatica MsbA of interest to researchers?

D. aromatica was initially isolated from Potomac River sludge contaminated with BTEX compounds (benzene, toluene, ethylbenzene and xylene) based on its ability to anaerobically degrade chlorobenzoate . This microbe is capable of aromatic hydrocarbon degradation and perchlorate reduction.

Additionally, MsbA's essentiality in Gram-negative bacteria makes it a promising target for novel antibiotics. The study of D. aromatica MsbA specifically provides insights into:

  • Membrane transport mechanisms in bioremediation-relevant bacteria

  • Structural adaptations in bacteria from contaminated environments

  • Potential targets for biotechnological applications

  • Comparative studies with MsbA homologs from other bacteria

How do different experimental environments affect the conformational states of MsbA?

The choice of membrane mimetic environment significantly impacts the conformational spectrum of MsbA. A systematic analysis using cryo-EM across a dozen different environments revealed :

  • Detergents generally favor a conformation with wide separation of the nucleotide-binding domains

  • Nanodiscs induce the narrow conformation

  • Only three of twelve tested environments allow MsbA to sample the full functional conformational spectrum, enabling complete movement of the NBDs between narrow and wide inward-facing conformations

This environmental sensitivity explains some of the contradictory structural observations in earlier studies. For instance, the large NBD separation observed in a previous 5.3 Å X-ray structure (PDB accession 3B5W) represented an extremely wide-open conformer whose physiological relevance was debated .

Researchers should be aware that:

  • Membrane protein structure determination typically requires isolation from the native lipid bilayer

  • The choice of detergent, amphipol, polymer, or membrane scaffold protein can strongly affect activity, stability, and conformational spectrum

  • This can potentially lead to errors or misinterpretation during analysis

What structural features allow MsbA to recognize lipid A?

Structural studies have revealed specific features critical for lipid A recognition by MsbA. In one study, a robust palm-shaped density between the two TMDs was resolved, with its size and shape consistent with an LPS molecule . The strongest parts of this LPS density correspond to:

  • Two glucosamines, each carrying one phosphate group (1-PO₄ and 4′-PO₄)

  • The inner core, containing multiple phosphorylations

The negative charge in these areas causes stronger electron scattering, generating densities readily visible in membrane-parallel slices through 3D reconstructions .

Mutational studies in homologous systems (e.g., Escherichia coli MsbA) revealed that residues like R188 and R238 are critical for lipid A binding, with thermodynamic coupling energies influencing substrate affinity.

How can researchers accurately model the interactions between MsbA and lipid A?

Modeling the interactions between MsbA and lipid A requires sophisticated approaches due to the complex nature of this membrane protein and its substrate. Based on published methodologies, researchers should consider :

  • Initial template selection:

    • Use high-resolution structures from homologous proteins (>35% identity)

    • The crystal structure of TM287/288 (PDB ID: 3QF4) may serve as a better template than lower resolution MsbA structures

  • Model refinement process:

    • Fit the model into cryo-EM maps using software like UCSF Chimera

    • Manually adjust the model in Coot

    • Refine in phenix.real_space_refine with secondary structure restraints enabled

  • LPS/lipid A modeling:

    • Start with LPS models from crystal structures like the TLR4-MD-2-LPS complex (PDB ID: 3FXI)

    • Fit into EM density in Chimera

    • Manually refine in Coot with restraints generated by the PRODRG server

  • Limitations to acknowledge:

    • EM densities may be too short to accommodate the full length of acyl chains due to flexibility

    • Limited resolution may prevent precise atomic positioning

    • Heterogeneity in LPS species can complicate interpretation

For accurate modeling, researchers should integrate data from multiple techniques, including X-ray crystallography, cryo-EM, and functional assays.

What expression systems are most effective for recombinant production of D. aromatica MsbA?

Based on commercial protein production data and research protocols, Escherichia coli appears to be the predominant expression system for recombinant D. aromatica MsbA . The effectiveness of expression systems can be compared as follows:

Expression SystemAdvantagesDisadvantagesReported Yield
E. coli- Well-established protocols
- High yield
- Cost-effective
- Potential for inclusion bodies
- May lack post-translational modifications
Not explicitly reported for D. aromatica MsbA
Yeast- Better for folding complex proteins
- Some post-translational modifications
- Lower yield than E. coli
- More expensive
Not explicitly reported for D. aromatica MsbA

For optimal expression, researchers should consider:

  • Fusion tags: His-tags are commonly employed for purification purposes

  • Protein length: Both full-length (1-585) and partial constructs are reported in commercial offerings

  • Buffer conditions: Tris/PBS-based buffers with ~6% trehalose at pH 8.0 are utilized for storage

  • Storage recommendations: Lyophilized powder stored at -20°C/-80°C, with reconstituted protein stored with 50% glycerol

Repeated freezing and thawing should be avoided, with working aliquots stored at 4°C for up to one week .

How can researchers assess the ATPase activity of MsbA, and what factors modulate it?

The ATPase activity of MsbA is central to its transport function and can be assessed through several methods:

  • Fluorescent labeling approach:

    • MsbA can be labeled stoichiometrically with fluorescent probes like MIANS [2-(4′-maleimidylanilino)naphthalene-6-sulfonic acid] on specific residues (e.g., C315 in E. coli MsbA)

    • This allows monitoring of conformational changes during substrate binding and ATP hydrolysis

  • Factors that modulate ATPase activity:

    • Lipid A binding: MsbA homologs show ATPase activity stimulated by hexa-acylated lipid A, with a 4–5-fold increase in activity observed in E. coli MsbA upon lipid binding

    • Amphipathic drugs: These compounds can alter protein conformation, as indicated by reduced initial rates of MsbA labeling by MIANS in their presence

    • Membrane environment: The lipid composition and physical properties of the membrane significantly affect ATPase activity

  • Quantitative measurements:

    • While specific ATPase activity values for D. aromatica MsbA are not reported in the search results, E. coli MsbA shows activity in the range of 37–154 nmol ATP/min/mg (lipid-dependent)

  • Inhibitor studies:

    • First-generation inhibitors like TBT1 collapse MsbA into inward-facing conformations, blocking lipid transport

    • Vanadate can be used to trap the protein in post-hydrolysis conformations

What approaches can be used to study the conformational changes of MsbA during the transport cycle?

Several complementary approaches can be employed to study MsbA conformational changes:

  • Cryo-electron microscopy (cryo-EM):

    • Provides high-resolution structural information in different conformational states

    • Can capture MsbA in various nucleotide states (e.g., nucleotide-free, ADP-bound, vanadate-trapped)

    • Enables visualization of substrate binding and protein rearrangements

  • X-ray crystallography:

    • Has yielded structures of MsbA in different conformations

    • Particularly useful for capturing specific states stabilized by nucleotides or inhibitors

    • The resulting models provide atomic-level details of nucleotide binding sites and substrate interactions

  • Fluorescence spectroscopy:

    • Labeled MsbA (e.g., MsbA-MIANS) can report on conformational changes

    • The fluorescence can be quenched by nucleotides, lipid A, and various drugs, providing estimates of binding affinities

    • Changes in fluorescence intensity or emission spectra can track structural transitions

  • Environmental variation studies:

    • Systematic analysis of MsbA in different membrane mimetics (detergents, amphipols, nanodiscs) reveals how environment affects conformational sampling

    • Only certain environments allow observation of the full conformational spectrum

  • Biosensor development:

    • Reconstituted MsbA in lipid bilayers enables real-time analysis of transporter dynamics and inhibitor effects

    • Can be coupled with electrical or optical detection methods

How does D. aromatica MsbA compare to MsbA homologs from other bacteria?

Comparative analysis reveals both similarities and differences between D. aromatica MsbA and its homologs:

FeatureD. aromatica MsbAE. coli MsbAOther Homologs
Sequence Length585 amino acidsSimilar lengthVaries slightly between species
Expression SystemE. coli or yeastNative or recombinant in E. coliVarious systems
ATPase ActivityNot explicitly reported37–154 nmol ATP/min/mg (lipid-dependent)Variable depending on species
ThermostabilityStable at -80°C (lyophilized)Tm ~50-55°CVariable
Key Functional ResiduesLikely conserved (e.g., R188, R238 equivalents)R188, R238 critical for lipid A bindingConserved in most homologs

While core features of the lipid A transport mechanism are likely conserved across bacterial species, the specific adaptations in D. aromatica may reflect its unique ecological niche in contaminated environments .

How can researchers investigate the substrate specificity of D. aromatica MsbA?

Investigating substrate specificity of D. aromatica MsbA can be approached through multiple experimental strategies:

  • Direct binding assays:

    • Utilize fluorescently labeled MsbA (similar to MsbA-MIANS) to measure binding of different substrates through fluorescence quenching

    • Compare affinity for different lipid A variants, phospholipids, and potential xenobiotic compounds

  • Stimulation of ATPase activity:

    • Measure how different substrates affect the rate of ATP hydrolysis

    • Compare the effects of lipid A from different sources, structurally modified lipid A, and other lipids

    • Investigate whether aromatic compounds relevant to D. aromatica's environment (e.g., BTEX compounds) interact with MsbA

  • Structural studies:

    • Co-crystallization or cryo-EM studies with different potential substrates

    • Investigate binding of substrates in different nucleotide states

    • Molecular docking and simulation studies to predict binding modes

  • Transport assays:

    • Reconstitute MsbA in liposomes with fluorescently labeled substrates

    • Measure ATP-dependent translocation of substrates across the membrane

    • Develop competition assays between known substrates and potential novel substrates

  • Mutagenesis studies:

    • Identify and mutate residues potentially involved in substrate recognition

    • Compare effects of mutations on transport or binding of different substrates

    • Create chimeric proteins with domains from MsbA homologs to identify regions responsible for substrate specificity

What are the critical differences in MsbA function between anaerobic and aerobic bacteria?

While the search results don't directly address the differences in MsbA function between anaerobic and aerobic bacteria, we can infer potential variations based on the information about D. aromatica, which can grow under both anaerobic and aerobic conditions :

  • Lipid A/LPS composition differences:

    • Bacteria growing in anaerobic vs. aerobic conditions may produce structurally different lipid A

    • These structural differences could affect MsbA binding and transport efficiency

    • The acylation pattern of lipid A is known to affect its interaction with MsbA

  • Membrane composition and fluidity:

    • Anaerobic growth often leads to changes in membrane lipid composition

    • Such changes could affect MsbA conformational flexibility and transport activity

    • The membrane environment has been shown to significantly impact MsbA structure and function

  • Energy considerations:

    • ATP availability may differ between aerobic and anaerobic growth conditions

    • This could affect the kinetics of MsbA-mediated transport

    • Alternative energy coupling mechanisms might exist under extreme energy limitation

  • Redox sensitivity:

    • MsbA contains cysteine residues that could be sensitive to the redox environment

    • Oxidative stress under aerobic conditions might affect MsbA structure and function

    • Conformational changes could be influenced by redox state of key residues

Researchers investigating these differences should consider:

  • Comparing MsbA activity in membranes derived from anaerobically vs. aerobically grown cells

  • Examining the effect of oxygen tension on recombinant MsbA structure and function

  • Investigating whether redox agents affect MsbA activity differently in proteins from obligate anaerobes vs. aerobes

How can D. aromatica MsbA be utilized in antibiotic development research?

As an essential transporter in Gram-negative bacteria, MsbA represents a promising target for novel antibiotics. Researchers can exploit D. aromatica MsbA in antibiotic development through several approaches:

  • High-throughput screening platforms:

    • Develop assays using purified recombinant D. aromatica MsbA to screen for inhibitors

    • ATPase activity assays can identify compounds that interfere with energy coupling

    • Fluorescence-based binding assays can identify compounds that compete with lipid A

  • Structure-based drug design:

    • Utilize high-resolution structures to identify potential binding pockets

    • Design compounds that stabilize MsbA in inactive conformations

    • Target the interface between the transmembrane domains and nucleotide-binding domains

  • Comparative studies:

    • Examine differences between MsbA from various pathogenic bacteria and human ABC transporters

    • Identify bacterial-specific features that could be selectively targeted

    • Investigate whether D. aromatica MsbA has unique features that could inform antibiotic development for other species

  • Resistance mechanism studies:

    • Investigate how mutations in MsbA might confer resistance to inhibitors

    • Develop strategies to overcome potential resistance mechanisms

    • Design combination approaches targeting multiple steps in LPS transport

  • First-generation inhibitors:

    • Building on known inhibitors like TBT1 that collapse MsbA into inward-facing conformations

    • Optimize these molecules for improved potency and pharmacokinetic properties

    • Develop analogues that can penetrate the outer membrane of Gram-negative bacteria

What methodologies are most effective for studying membrane protein-lipid interactions in MsbA systems?

Studying membrane protein-lipid interactions in MsbA systems requires specialized approaches due to the complex nature of these interactions. Based on the search results and current methodologies, effective approaches include:

  • Cryo-electron microscopy:

    • Has successfully resolved lipid A/LPS bound to MsbA in different conformational states

    • Can visualize both protein and lipid densities, revealing binding orientations

    • Enables observation of conformational changes upon lipid binding

  • Native mass spectrometry:

    • Can detect intact membrane protein-lipid complexes

    • Provides information on binding stoichiometry and relative affinities

    • Requires careful optimization of ionization conditions to preserve interactions

  • Fluorescence-based methods:

    • Fluorescently labeled MsbA (e.g., with MIANS) can report on lipid binding

    • Förster resonance energy transfer (FRET) between labeled protein and lipids can track dynamics

    • Environment-sensitive fluorophores can detect changes in local environment upon lipid binding

  • Reconstitution systems:

    • Nanodiscs provide a native-like membrane environment while maintaining accessibility

    • Different lipid compositions can be tested systematically

    • Only certain reconstitution systems allow MsbA to sample its full conformational spectrum

  • Molecular dynamics simulations:

    • Can model protein-lipid interactions at atomic resolution

    • Predict how lipids affect protein dynamics and vice versa

    • Test hypotheses about the mechanism of lipid flipping

For D. aromatica MsbA specifically, researchers should be aware of the environmental sensitivity of this protein and choose systems that allow physiologically relevant conformational sampling .

How might research on D. aromatica MsbA contribute to understanding bacterial adaptation to environmental contaminants?

D. aromatica was initially isolated from Potomac River sludge contaminated with BTEX compounds and is capable of aromatic hydrocarbon degradation and perchlorate reduction . Research on its MsbA transporter could provide insights into bacterial adaptation to contaminated environments:

  • Membrane barrier function:

    • MsbA's role in LPS transport directly affects outer membrane permeability

    • Modifications to MsbA function could represent adaptations to maintain membrane integrity in the presence of lipophilic contaminants

    • Comparison with MsbA from non-adapted bacteria might reveal structural adaptations

  • Xenobiotic efflux potential:

    • Some ABC transporters can export toxic compounds

    • MsbA has been linked to efflux of amphipathic drugs in other bacteria

    • D. aromatica MsbA might have evolved broader substrate specificity to handle environmental toxins

  • Lipid A modifications in response to stress:

    • Bacteria often modify their lipid A structure in response to environmental stress

    • These modifications could affect MsbA-lipid A interactions

    • Understanding how D. aromatica MsbA accommodates potentially modified lipid A could reveal adaptation mechanisms

  • Bioremediation applications:

    • Insights into D. aromatica MsbA might inform engineering of bacteria for enhanced bioremediation

    • Manipulation of membrane transport systems could improve tolerance to toxic compounds

    • Understanding the limitations of native systems could guide synthetic biology approaches

  • Cross-tolerance mechanisms:

    • Adaptation to one stressor (e.g., aromatic hydrocarbons) might confer tolerance to others

    • MsbA adaptations could represent general stress response mechanisms

    • Comparative studies with MsbA from bacteria from non-contaminated environments could reveal specific adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.