Recombinant Dechloromonas aromatica Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; Daro_3906; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Dechloromonas aromatica (strain RCB)
Target Names
mtgA
Target Protein Sequence
MKILGRWLKLLLLGLIGLFLVWQLWLLGWVLLWGWVNPGETRFMAIRLAELRQKVPEAQL KQQWVPYERISIHLKRAIIAAEDAKFVDHEGFDWEGIQKAMEKNQKKGRFVAGGSTISQQ LAKNLFLTPTKSYFRKVEEAIITLMLENLWSKKRIFEVYLNVIEWGNGVFGAEAAARHYY NTSAAQLGPEQAARLAGMVPNPRYYDRNRSAQGLGRKTAIILARMPAADVP
Uniprot No.

Target Background

Function

Function: Recombinant Dechloromonas aromatica Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Dechloromonas aromatica and why is it significant for peptidoglycan research?

Dechloromonas aromatica strain RCB is a unique organism in pure culture capable of oxidizing benzene in the absence of oxygen. This bacterium can also oxidize other aromatics such as toluene, benzoate, and chlorobenzoate, coupling growth and benzene oxidation to the reduction of O2, chlorate, or nitrate. D. aromatica completely mineralizes benzene to CO2, making it valuable for bioremediation applications .

From a peptidoglycan perspective, D. aromatica represents an interesting model for studying bacterial cell wall components in an organism with unusual metabolic capabilities. Its genome analysis reveals evidence for several metabolic pathways previously unobserved experimentally, including unique cell wall components .

  • What is the function of monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in bacterial cell walls?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a critical enzyme involved in bacterial cell wall biosynthesis. Unlike bifunctional penicillin-binding proteins (PBPs) that possess both transglycosylase and transpeptidase domains, mtgA exclusively catalyzes glycosyltransferase reactions, polymerizing lipid II precursors into longer glycan strands that form the backbone of peptidoglycan .

In the peptidoglycan synthesis process, mtgA specifically mediates the formation of β-1,4-glycosidic bonds between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) sugar moieties. This polymerization activity creates the glycan strand foundation upon which crosslinking peptide bonds later form to generate the complete cell wall mesh structure .

  • How does peptidoglycan structure contribute to bacterial cell integrity and function?

Peptidoglycan defines cell shape and protects bacteria against osmotic stress. The growth and integrity of peptidoglycan require coordinated actions between:

  • Synthases that insert new peptidoglycan strands

  • Hydrolases that generate openings to allow insertion

This complex polymer forms a net-like heteropolymer of glycan strands composed of repeats of the disaccharide N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc), crosslinked by short peptides .

The resulting structure provides:

  • Structural integrity against turgor pressure

  • Cell shape determination

  • Protection against environmental challenges

  • A framework for cell division processes

Disruption of peptidoglycan synthesis or regulation can lead to cell shape abnormalities or lysis, as demonstrated in studies showing that inhibited PBP1a2 (a penicillin-binding protein) accelerates the degradation of cell poles by hydrolytic peptidases .

Research Methodology Questions

  • What experimental controls are necessary when studying recombinant D. aromatica mtgA enzyme kinetics?

When studying recombinant D. aromatica mtgA enzyme kinetics, the following controls are essential:

Negative Controls:

  • Heat-inactivated enzyme preparation

  • Reaction mixture without enzyme

  • Reaction mixture without substrate

  • Non-catalytic mutant version of mtgA (e.g., with mutations in catalytic residues)

Positive Controls:

  • Well-characterized transglycosylase from model organism (e.g., E. coli mtgA)

  • Commercial transglycosylase if available

  • mtgA from closely related bacteria with known activity profiles

Substrate Controls:

  • Varying substrate concentrations for Michaelis-Menten kinetics

  • Different lipid II variants to assess substrate specificity

  • Radiolabeled or fluorescently labeled substrates with appropriate label-only controls

Inhibitor Controls:

  • Known transglycosylase inhibitors (e.g., moenomycin)

  • Concentration gradients of inhibitors

  • Beta-lactam antibiotics (which should not affect transglycosylase activity)

Environmental Parameter Controls:

  • pH range tests (typically pH 5.5-8.5)

  • Temperature dependence studies

  • Metal ion dependency analysis (presence/absence of Mg2+, Mn2+, etc.)

For rigorous kinetic analysis, researchers should:

  • Determine Km and Vmax under standard conditions

  • Assess product inhibition effects

  • Evaluate cooperativity through Hill plot analysis

  • Examine the effects of various environmental factors on kinetic parameters

  • How can researchers effectively compare the structural and functional characteristics of peptidoglycan transglycosylases across different bacterial species?

Effective comparison of peptidoglycan transglycosylases across bacterial species requires a multi-level approach:

Sequence-Based Analysis:

  • Multiple Sequence Alignment: Align mtgA sequences from diverse species to identify:

    • Conserved catalytic residues

    • Species-specific insertions or deletions

    • Domain architecture variations

  • Phylogenetic Analysis: Construct phylogenetic trees to understand evolutionary relationships and potential functional divergence.

  • Conservation Mapping: Project sequence conservation onto known structures to identify functionally important regions.

Structural Analysis:

  • Homology Modeling: Generate structural models of D. aromatica mtgA based on crystallized homologs.

  • Structural Superposition: Compare models to identify:

    • Active site geometry differences

    • Substrate binding pocket variations

    • Surface electrostatic potential differences

  • Molecular Dynamics Simulations: Assess dynamic behavior differences in solution.

Functional Characterization:

  • Expression in Common Host: Express multiple species' mtgA in the same host system for direct activity comparison.

  • Standardized Activity Assays: Use identical substrates and conditions for comparative kinetic analysis.

  • Cross-Species Complementation: Test ability of D. aromatica mtgA to complement mtgA-deficient strains of model organisms.

Comprehensive Comparison Matrix:

FeatureE. coli mtgAD. aromatica mtgAOther Species mtgA
Molecular WeightX kDaY kDaZ kDa
pI ValueXYZ
Km for Lipid IIX μMY μMZ μM
VmaxX μmol/min/mgY μmol/min/mgZ μmol/min/mg
Optimal pHXYZ
Optimal TemperatureX°CY°CZ°C
Metal Ion RequirementXYZ
Inhibition by Moenomycin (IC50)X nMY nMZ nM

This multi-faceted comparative approach would help highlight unique adaptations in D. aromatica mtgA potentially related to its environmental niche and metabolic capabilities .

  • What are the potential applications of recombinant D. aromatica mtgA in synthesizing modified peptidoglycan structures for antimicrobial research?

Recombinant D. aromatica mtgA offers promising applications in synthesizing modified peptidoglycan structures for antimicrobial research:

Engineering Modified Peptidoglycan:

  • Chemoenzymatic Synthesis: Utilize recombinant mtgA to polymerize:

    • Custom-designed lipid II analogues with modified peptide stems

    • Fluorescently or isotopically labeled building blocks

    • Lipid II variants with altered sugar moieties

  • Production of Defined Length Oligomers: Control reaction conditions to generate peptidoglycan fragments of specific lengths for structure-activity relationship studies.

  • Hybrid Structures: Combine D. aromatica mtgA with other bacterial transglycosylases to create chimeric peptidoglycan with unique properties.

Antimicrobial Research Applications:

  • Novel Antibiotic Target Validation:

    • Generate substrate analogues to probe binding sites of peptidoglycan-targeting antibiotics

    • Develop fluorescence-based high-throughput screening assays for transglycosylase inhibitors

  • Immune Response Studies:

    • Synthesize defined peptidoglycan fragments to study NOD1/NOD2 receptor activation

    • Investigate how peptidoglycan structure influences innate immune recognition

  • Bacterial Cell Wall Permeability:

    • Create modified peptidoglycan to study how structural changes affect antibiotic penetration

    • Assess impact of glycan strand length and crosslinking on cell wall permeability

Recent research has revealed that LD-crosslinks within peptidoglycan act as inhibitors of lytic transglycosylase activity and provide resistance against predatory lytic transglycosylases . This insight could be exploited using recombinant D. aromatica mtgA to engineer peptidoglycan with controlled susceptibility to degradation, potentially creating structures that enhance antibiotic efficacy through modified cell wall dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.