Recombinant Dechloromonas aromatica NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Recombinant Production

nuoK (UniProt ID: Q47HG6) is a 103-amino acid subunit of the NDH-1 complex in Dechloromonas aromatica. Recombinant nuoK is produced in E. coli with an N-terminal His tag for purification via affinity chromatography .
Key Specifications

ParameterDetail
Source OrganismDechloromonas aromatica (strain RCB)
Gene NamenuoK (Daro_0959)
Protein LengthFull-length (1–103 aa)
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol

Functional Role in the NADH-Quinone Oxidoreductase Complex

NDH-1 catalyzes the oxidation of NADH to NAD⁺ and reduces quinones (e.g., ubiquinone), coupling electron transfer to proton translocation across the membrane . nuoK likely contributes to structural stability or electron transfer intermediates.

Electron Transfer Pathway

  1. NADH oxidation: Occurs in peripheral subunits (e.g., NuoG, NuoF).

  2. Quinone reduction: Mediated by membrane subunits (e.g., NuoL, NuoM).

  3. Proton translocation: Driven by conformational changes in membrane subunits.

nuoK’s exact role remains under investigation, but its homologs in E. coli (e.g., NuoI) participate in electron transfer via iron-sulfur clusters .

Research Applications and Findings

Recombinant nuoK is used in:

  • Structural studies: To model NDH-1 subunit interactions.

  • Enzyme kinetics: To study quinone binding and electron transfer efficiency.

  • Drug discovery: As a target for antibacterial agents disrupting proton translocation.

Comparative Analysis with Other NADH-Quinone Oxidoreductases

FeatureNDH-1 (nuoK)NDH-2 (Single-subunit)
Subunit StructureMulti-subunit (13–15 subunits)Single-subunit (40–70 kDa)
Proton TranslocationYes (via membrane subunits)No
Quinone ReductionUbiquinone/menaquinoneUbiquinone/menaquinone
Catalytic CofactorsFAD, Fe-S clustersFAD/FMN

Data synthesized from .

Gene and Protein Information

ParameterDetail
Gene SynonymsnuoK, Daro_0959, NADH dehydrogenase I subunit K
EC Number1.6.99.5 (NADH:quinone oxidoreductase)
Related EnzymesE. coli NuoI, Vibrio cholerae Na⁺-NQR, Saccharomyces Ndi1P
Expression SystemE. coli (inducible vectors)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
nuoK; Daro_0959; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Dechloromonas aromatica (strain RCB)
Target Names
nuoK
Target Protein Sequence
MLTLSLSHFLILGAILFAISVVGIFLNRKNLLVLLMAIELMLLAVNMNFVAFSHYLQDLS GQIFVFFILTVAAAESAIGLAILIVLFRNLKSIHVDDLGSLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thus conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) in Dechloromonas aromatica?

NADH-quinone oxidoreductase subunit K (nuoK) is a 103-amino acid protein that functions as an integral component of the NADH dehydrogenase I (NDH-1) complex in Dechloromonas aromatica. This protein is encoded by the nuoK gene (also known as Daro_0959) and is part of the nuoA-N operon that codes for Type I NADH dehydrogenase . The protein has a UniProt ID of Q47HG6 and plays a crucial role in the electron transport chain of D. aromatica, which is a bacterium noted for its unique metabolic capabilities including anaerobic degradation of aromatic compounds and reduction of perchlorate .

How is recombinant D. aromatica nuoK protein prepared for laboratory studies?

The recombinant protein is typically expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. According to product specifications, the protein is supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis . For optimal handling:

ParameterRecommendation
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Storage conditions-20°C/-80°C with 5-50% glycerol
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
Short-term storageWorking aliquots at 4°C for up to one week
Handling precautionsAvoid repeated freeze-thaw cycles

Prior to opening, brief centrifugation is recommended to bring contents to the bottom of the vial .

What are the optimal conditions for expressing recombinant D. aromatica nuoK in heterologous systems?

For optimal expression of recombinant D. aromatica nuoK, researchers should consider several critical parameters to maximize yield while maintaining proper protein folding:

  • Expression vector selection: Vectors with tightly regulated promoters are preferable for membrane proteins like nuoK to prevent toxicity from overexpression.

  • Host strain considerations: E. coli strains specifically designed for membrane protein expression (such as C41/C43(DE3) derivatives) generally produce better results than standard BL21(DE3) strains.

  • Induction parameters: Lower temperatures (16-25°C) and reduced inducer concentrations typically yield better results for membrane proteins by slowing expression and allowing proper folding.

  • Media supplementation: Addition of specific lipids or membrane-stabilizing compounds can improve yield and quality of the expressed protein.

  • Extraction optimization: Careful selection of detergents for membrane solubilization is critical for maintaining the native conformation of nuoK during purification.

The successfully expressed protein should be verified not only by SDS-PAGE but also by functional assays to ensure the recombinant protein maintains its native activity within the NADH dehydrogenase complex .

How can researchers investigate the role of nuoK in D. aromatica's unique metabolic capabilities?

D. aromatica has garnered significant scientific interest due to its remarkable ability to degrade benzene anaerobically and reduce perchlorate, making it valuable for bioremediation applications . To investigate nuoK's specific contribution to these metabolic capabilities, researchers might employ:

  • Gene knockout studies: Creating ΔnuoK mutants to assess the impact on various metabolic pathways, particularly focusing on:

    • Anaerobic benzene degradation efficiency

    • Perchlorate reduction capabilities

    • Growth rates under various electron acceptor conditions

  • Complementation experiments: Reintroducing native or modified nuoK genes to knockout strains to confirm phenotype restoration.

  • Transcriptomic analysis: RNA-sequencing under different growth conditions to understand nuoK expression patterns in relation to specific metabolic pathways.

  • Isotope labeling studies: Similar to the transcriptome-stable isotope probing (RNA-SIP) approach mentioned in the search results , using 13C-labeled substrates to track carbon flow through metabolic pathways in relation to nuoK expression.

  • Protein-protein interaction studies: Identifying interactions between nuoK and other proteins involved in hydrocarbon degradation or perchlorate reduction pathways.

These approaches would provide insights into how this respiratory chain component contributes to D. aromatica's unique metabolic versatility.

What experimental approaches can elucidate the structure-function relationship of nuoK in the respiratory chain?

To establish structure-function relationships for nuoK in D. aromatica's respiratory chain, researchers might employ:

  • Site-directed mutagenesis: Creating a library of point mutations targeting:

    • Conserved residues identified through multiple sequence alignments

    • Predicted transmembrane domains

    • Residues potentially involved in proton translocation

    • Interface regions with other complex subunits

  • Chimeric protein construction: Swapping domains between nuoK and homologous proteins from other organisms to identify functionally critical regions.

  • Structural biology approaches:

    • Cryo-electron microscopy of the entire NADH dehydrogenase complex

    • Solid-state NMR of reconstituted protein in membrane mimetics

    • X-ray crystallography of the purified complex

  • Computational methods:

    • Molecular dynamics simulations to model proton movement through the complex

    • Homology modeling based on structurally characterized homologs

    • Quantum mechanics calculations for electron transfer kinetics

  • Biophysical characterization:

    • Circular dichroism spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to monitor conformational changes

    • EPR spectroscopy to track electron movement

These approaches would help elucidate how nuoK's structure contributes to its function in the complex respiratory mechanisms of D. aromatica.

What techniques are most effective for studying the integration of nuoK into membrane structures?

Investigating membrane integration of nuoK requires specialized techniques that preserve native membrane interactions:

  • Membrane extraction and fractionation:

    • Differential ultracentrifugation to isolate membrane fractions

    • Detergent solubilization screening to identify optimal extraction conditions

    • Density gradient separation to purify membrane complexes

  • Topological analysis:

    • Protease accessibility mapping to determine exposed regions

    • Reporter fusion constructs to identify transmembrane orientation

    • Chemical labeling of accessible residues

  • Reconstitution systems:

    • Proteoliposome preparation with defined lipid compositions

    • Nanodiscs for single-complex studies

    • Giant unilamellar vesicles for functional studies

  • Advanced microscopy:

    • Freeze-fracture electron microscopy to visualize membrane complexes

    • Atomic force microscopy for surface topology analysis

    • Super-resolution fluorescence microscopy with tagged proteins

These approaches provide complementary information about how nuoK integrates into membranes and interacts with other components of the respiratory chain .

How should researchers approach the purification of recombinant nuoK while maintaining its native conformation?

Purification of membrane proteins like nuoK presents unique challenges requiring specialized protocols:

Purification StepMethodological ApproachCritical Considerations
Membrane extractionDetergent solubilizationSelection of mild detergents (DDM, LMNG, etc.) at concentrations just above CMC
Initial purificationIMAC using Ni-NTA resinBuffer optimization to maintain protein stability; inclusion of detergent above CMC
Secondary purificationSize exclusion chromatographyRemoval of aggregates and isolation of homogeneous protein-detergent complexes
Quality assessmentAnalytical SEC; thermal stability assaysMonitoring monodispersity and conformational stability
StorageBuffer optimization with stabilizing additivesAs noted in the product information: Tris/PBS buffer with 6% Trehalose, pH 8.0

Throughout purification, it is essential to verify that the recombinant protein maintains its native fold and activity. This can be assessed through activity assays, if possible, or through biophysical techniques such as circular dichroism or fluorescence spectroscopy.

What controls and validation steps are necessary when studying nuoK function in vitro?

When investigating nuoK function in reconstituted systems, essential controls and validation steps include:

  • Protein quality controls:

    • SDS-PAGE to confirm purity (>90% as specified for the recombinant protein)

    • Western blotting with anti-His antibodies to verify integrity

    • Mass spectrometry to confirm sequence and post-translational modifications

  • Functional validation:

    • NADH oxidation assays to confirm electron transfer capability

    • Proton translocation measurements in reconstituted systems

    • Comparison with known activities of homologous proteins

  • Structural integrity verification:

    • Circular dichroism to confirm secondary structure content

    • Limited proteolysis to assess proper folding

    • Thermal stability assays to evaluate protein stability

  • Reconstitution controls:

    • Empty liposomes/nanodiscs as negative controls

    • Reconstitution with known functional proteins as positive controls

    • Verification of protein orientation in reconstituted systems

  • Experimental replicates and statistical analysis:

    • Biological replicates from independent protein preparations

    • Technical replicates to assess measurement precision

    • Appropriate statistical tests to evaluate significance of results

These validation steps ensure that observations accurately reflect nuoK function rather than artifacts of the experimental system.

How does nuoK function contribute to D. aromatica's bioremediation capabilities?

D. aromatica has drawn significant attention in environmental biotechnology due to its ability to degrade toxic aromatic compounds anaerobically and reduce perchlorate . The nuoK protein, as part of the NADH-quinone oxidoreductase complex, likely plays several critical roles in these bioremediation processes:

  • Energy conservation: By contributing to proton translocation and ATP synthesis, nuoK helps maintain cellular energy levels during the energetically challenging process of anaerobic aromatic compound degradation.

  • Redox balance: The NADH dehydrogenase complex helps maintain appropriate NADH/NAD+ ratios during degradation of pollutants.

  • Electron transport: The complex facilitates electron flow to various terminal electron acceptors that D. aromatica can utilize in contaminated environments (nitrate, perchlorate, etc.).

  • Adaptation to microoxic conditions: As noted in the search results, the nuoA-N operon is expressed in microoxic microcosms , suggesting it plays a role in respiration under the limited oxygen conditions often found in contaminated sites.

Understanding nuoK's specific contributions to these processes could inform genetic engineering approaches to enhance D. aromatica's bioremediation capabilities.

How do environmental conditions affect nuoK expression and function in bioremediation contexts?

Environmental factors likely modulate nuoK expression and function in ways that impact D. aromatica's bioremediation performance:

  • Oxygen availability: D. aromatica thrives in both aerobic and anaerobic environments , with the nuoA-N operon expressed in microoxic conditions . The precise regulation of nuoK under varying oxygen tensions requires further investigation.

  • Contaminant profile: Different pollutants may elicit different expression patterns of respiratory chain components. Transcriptomic studies have shown that while nuoA-N transcripts were present in hydrocarbon degradation experiments, they were not heavily labeled with 13C , suggesting complex regulation based on carbon source.

  • Soil/sediment composition: The physical and chemical properties of contaminated environments likely influence membrane composition and consequently nuoK function.

  • Community interactions: D. aromatica's genome contains evidence of interactions with other organisms , which may affect nuoK expression through quorum sensing or other signaling mechanisms.

  • Redox conditions: As different terminal electron acceptors become available or depleted, the function and importance of nuoK in the respiratory chain may shift.

Systematic studies correlating environmental parameters with nuoK expression and function would provide valuable insights for optimizing bioremediation strategies.

What research gaps remain in understanding nuoK's role in D. aromatica metabolism?

Despite advances in characterizing D. aromatica and its metabolic capabilities, several critical knowledge gaps regarding nuoK remain:

  • Structure-function relationship: The precise structural features of nuoK that enable its function in the NADH dehydrogenase complex remain uncharacterized.

  • Regulatory mechanisms: How expression of the nuoK gene is regulated in response to different environmental conditions and pollutants is not fully understood.

  • Interaction with other metabolic pathways: The connection between nuoK function and D. aromatica's unique capabilities, such as anaerobic benzene degradation, requires further elucidation.

  • Evolutionary adaptations: How nuoK in D. aromatica may differ from homologs in related bacteria lacking similar degradative capabilities represents an interesting area for comparative genomics.

  • Post-translational modifications: Potential modifications that might modulate nuoK function under different environmental conditions have not been characterized.

Addressing these knowledge gaps would provide a more comprehensive understanding of how this subunit contributes to D. aromatica's remarkable metabolic versatility and environmental significance.

How does nuoK in D. aromatica compare with homologous proteins in other bacteria?

Comparative analysis of nuoK across bacterial species can provide insights into its specialized functions in D. aromatica:

  • Sequence conservation: While the nuoK protein is broadly conserved across bacteria with Type I NADH dehydrogenase complexes, specific sequence variations in D. aromatica might reflect adaptations to its unique metabolism.

  • Structural differences: Subtle structural variations, particularly in transmembrane regions, might contribute to different proton translocation efficiencies or coupling ratios.

  • Genomic context: Analysis of the nuoA-N operon organization in D. aromatica compared to other bacteria might reveal regulatory differences that enable responsive adaptation to varying environmental conditions.

  • Functional adaptation: The metabolic versatility of D. aromatica, especially its ability to degrade aromatic compounds anaerobically , suggests potential specialized adaptations in its respiratory chain components, including nuoK.

Genome analyses have already indicated "a high level of diversification between [D. aromatica's] predicted capabilities and those of its close relatives, A. aromaticum str EbN1 and Azoarcus BH72" , suggesting nuoK may have species-specific features worth investigating.

What insights can be gained from studying nuoK in the context of D. aromatica's evolutionary adaptations?

Evolutionary analysis of nuoK can provide insights into D. aromatica's adaptation to challenging environmental niches:

  • Selective pressures: The evolutionary history of nuoK might reflect adaptation to environments with fluctuating oxygen levels and the presence of aromatic pollutants.

  • Gene duplication events: Genome analysis of D. aromatica has revealed "examples of recent gene duplication events" , though the search results do not specifically mention nuoK in this context.

  • Horizontal gene transfer: Examining whether nuoK or the broader NADH dehydrogenase complex shows evidence of horizontal gene transfer could reveal important evolutionary mechanisms.

  • Co-evolution with metabolic pathways: The evolution of nuoK might be linked to the development of D. aromatica's unique metabolic capabilities, such as anaerobic benzene degradation.

  • Comparative genomics: Systematic comparison of nuoK across the Rhodocyclaceae family could reveal how this protein has evolved in concert with different metabolic strategies.

Such evolutionary analyses could provide context for understanding how nuoK contributes to D. aromatica's remarkable metabolic versatility and environmental adaptability.

What emerging technologies could advance research on nuoK and respiratory chain components in D. aromatica?

Several cutting-edge technologies hold promise for deepening our understanding of nuoK function:

  • Cryo-electron microscopy: Advanced cryo-EM techniques could reveal the structure of the entire NADH dehydrogenase complex in D. aromatica at near-atomic resolution, clarifying nuoK's position and interactions.

  • Single-molecule studies: Technologies for studying individual protein complexes could provide insights into the dynamics of nuoK during electron transport and proton translocation.

  • In situ structural biology: Techniques for studying protein structures directly in bacterial cells could reveal native conformations of nuoK in its membrane environment.

  • Advanced genetic tools: CRISPR-Cas9 and other precision genome editing technologies could facilitate more sophisticated genetic manipulations of nuoK in D. aromatica.

  • Integrative multi-omics: Combining transcriptomics, proteomics, metabolomics, and fluxomics approaches could provide a systems-level understanding of nuoK's role in D. aromatica metabolism.

These technologies could overcome current limitations in studying membrane proteins like nuoK and provide unprecedented insights into their structure and function.

How might research on nuoK inform the development of enhanced bioremediation strategies?

Understanding nuoK function could contribute to bioremediation advances in several ways:

  • Engineered strains: Knowledge of how nuoK contributes to D. aromatica's respiratory capabilities could guide genetic engineering efforts to enhance pollutant degradation efficiency.

  • Biomarkers for monitoring: Understanding nuoK expression patterns could lead to the development of molecular markers for monitoring D. aromatica activity in contaminated sites.

  • Optimized environmental conditions: Insights into how environmental factors affect nuoK function could inform the design of optimal conditions for in situ bioremediation.

  • Predictive models: Mechanistic understanding of nuoK's role could contribute to models predicting D. aromatica's performance under various environmental conditions.

  • Novel applications: Detailed understanding of D. aromatica's respiratory chain might reveal unexpected capabilities relevant to emerging contaminants or challenging remediation scenarios.

Given D. aromatica's unique ability to degrade benzene anaerobically and reduce perchlorate , advances in understanding its respiratory machinery could have significant environmental implications.

What interdisciplinary approaches might yield new insights into nuoK function and applications?

Interdisciplinary research combining multiple fields could provide novel perspectives on nuoK:

  • Synthetic biology and protein engineering: Designing modified versions of nuoK to test hypotheses about structure-function relationships or to enhance specific activities.

  • Computational biology and machine learning: Developing predictive models of nuoK function based on sequence, structure, and experimental data.

  • Environmental microbiology and ecology: Studying nuoK expression and function in natural and engineered ecosystems to understand its role in community contexts.

  • Biophysics and nanotechnology: Developing new tools for manipulating and measuring the activity of membrane proteins like nuoK at the molecular level.

  • Systems biology and metabolic engineering: Integrating nuoK function into comprehensive models of D. aromatica metabolism to guide strain improvement efforts.

The complex nature of respiratory chain function and its importance in D. aromatica's unique metabolic capabilities make nuoK an ideal target for such interdisciplinary approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.